DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and Ir87a

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:489 Identity:97/489 - (19%)
Similarity:159/489 - (32%) Gaps:196/489 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 AMPRSPVETAGYQAVDGV---AARVVGEMLNASVTYVFPEDNESYGRCLPNGN--------YTGV 257
            |:|.:..::.|...:.|:   ..:.:.|.|:.|:        |..|.   |.|        ..|.
  Fly   395 AIPDTETQSGGKLKLSGIEYEMVQTIAERLHVSI--------EMQGE---NSNLYHLFQQLIDGE 448

  Fly   258 VSDIVGGHTHFAPNSRFVLDCIWPAVEVLYPYTRRNLHLVVPASAIQPEYLIFVRVFRRTVWYLL 322
            :..||||.......|:||...|        ||.:..|...|..:..:..:..||..|.....:|:
  Fly   449 IEMIVGGIDEDPSISQFVSSSI--------PYHQDELTWCVARAKRRHGFFNFVATFNADAGFLI 505

  Fly   323 LVTLLVVVLVFWVMQR-----------------------LQRRIPRRGVIQFQATWYEILEMFGK 364
            .:.::...||.|:.||                       |.:.||.:   .|..|..::..:   
  Fly   506 GIFVVTCSLVVWLAQRVSGFQLRNLNGYFPTCLRVLGILLNQAIPAQ---DFPITLRQLFAL--- 564

  Fly   365 THVGEPAGRLSSFSSMRTFLMGWILF----SYVLSTIYFAKLESGFVRPSYEEQVDRVDDLVHLD 425
                             :||||:...    |:::||:...       |.||:         :|..
  Fly   565 -----------------SFLMGFFFSNTYQSFLISTLTTP-------RSSYQ---------IHTL 596

  Fly   426 VHIYA--VTTMYDAVRSALTEHQ--------------------YGL---LENRSRQLPLGIAT-- 463
            ..||:  :|.|      ..:||.                    |.|   |.:.::...:.:|.  
  Fly   597 QEIYSNKMTVM------GTSEHVRHLNKDGEIFKYIREKFQMCYNLVDCLNDAAQNEHIAVAVSR 655

  Fly   464 --SYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAYHIAREYLRSMICTYILPRGSPFL 526
              |:|.|.: :|||...|                   :|      ||.|...:.|.:||:....|
  Fly   656 QHSFYNPRI-QRDRLYCF-------------------DR------RESLYVYLVTMLLPKKYHLL 694

  Fly   527 HRLESLYSGFLEHGFFEHW-RQMDL-------ITRVGASPDAEEFLEDLGDQTDTDSGSNELAIR 583
            |::..:....:|.|..:.| |.:|:       ||||...|..                       
  Fly   695 HQINPVIQHIIESGHMQKWARDLDMRRMIHEEITRVREDPFK----------------------- 736

  Fly   584 NKKVVLTLDILQGAFYLWSVGIGI--SCLGFAVE 615
                .||.|..:||. .:|.|:.:  ||: ||.|
  Fly   737 ----ALTFDQFRGAI-AFSGGLLLVASCV-FAFE 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 62/337 (18%)
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.