DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and Ir84a

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_649720.2 Gene:Ir84a / 40891 FlyBaseID:FBgn0037501 Length:644 Species:Drosophila melanogaster


Alignment Length:556 Identity:105/556 - (18%)
Similarity:192/556 - (34%) Gaps:169/556 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VWPNAGRHQLLRLFRGSWAKK--------LLYGLAITGRENGTFDFDPFAWGGLQVIQRLDGEVP 180
            :|.::|.:|....|:.:|..:        |:....:|.:..|..|.:..|  ..:.:|:||   |
  Fly   196 LWTHSGGYQKFGNFKNTWVIRRRNFLNVTLIGSTVLTEKPPGFGDMEYLA--DDKQLQQLD---P 255

  Fly   181 YARKVKDLRGYPLRFSMFTDPLMAMPRSPVETAGYQAVDGVAARVVGEMLNASVTYVFPEDNESY 245
            ..||.         :.:|                         ::|..|.|.|:....   .:.:
  Fly   256 MQRKT---------YQLF-------------------------QLVERMFNLSLAISL---TDKW 283

  Fly   246 GRCLPNGNYTGVVSDIVGGHTHFA--PNSRFVLDCIWPAVEVLYPYTR-------RNLHLVVPAS 301
            |..|.||:::||:..:......||  | .|||||        ..||.:       :|:|.:....
  Fly   284 GELLDNGSWSGVMGQVTSREADFAVCP-IRFVLD--------RQPYVQYSAVLHTQNIHFLFRHP 339

  Fly   302 AIQPEYLIFVRVFRRTVWY--LLLVTLLVVVLVFWV-MQRLQRRIPRRGVIQFQATWYEILEMFG 363
            .......||.......||:  |.|||...::|:|.| ::|:...:..|    |...|:.:||   
  Fly   340 RRSHIKNIFFEPLSNQVWWCVLALVTGSTILLLFHVRLERMLSNMENR----FSFVWFTMLE--- 397

  Fly   364 KTHVGE-PAGRLSSFSSMRTFLMGWILFSYVLSTIYFAKLESGFVRPSYEEQVDRVDDLVHLDVH 427
             |::.: ||..:....|.|..:....:||::|...|.|.:....:..|....|:           
  Fly   398 -TYLQQGPANEIFRLFSTRLLISLSCIFSFMLMQFYGAFIVGSLLSESARSIVN----------- 450

  Fly   428 IYAVTTMYD---AVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFIMRDFHARDF 489
               :..:||   |:......:.:.:..|.|.||.                 |..::.:...:.:.
  Fly   451 ---LQALYDSNLAIGMENISYNFPIFTNTSNQLV-----------------RDVYVKKICKSGEH 495

  Fly   490 LAITYDSQAERP-----AYHIAREYLRSMI----------CTY-------------ILPRGSPFL 526
            ..::....|||.     |:|.|.:.:..::          |..             ::|:|||:.
  Fly   496 NIMSLQQGAERIIQGRFAFHTAIDRMYRLLLELQMDEAEFCDLQEVMFNLPYDSGSVMPKGSPWR 560

  Fly   527 HRLESLYSGFLEHGFFEHWRQMDLITRVGASPDAEEFLEDLGDQTDTDSGSNELAIRNKKVVLTL 591
            ..|......|...|..::..:..::.|    ||...|                   :..:..:.|
  Fly   561 EHLAHALLHFRATGLLQYNDKKWMVRR----PDCSLF-------------------KTSQAEVDL 602

  Fly   592 DILQGAFYLWSVGIGISCLGFAVE-HAHW---FWRR 623
            :....|.:..::.:..|.|.|.:| ..||   |.||
  Fly   603 EHFAPALFALALAMVASALVFLLELFLHWLPDFRRR 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 48/306 (16%)
Ir84aNP_649720.2 nt_trans <54..>112 CDD:294020
Periplasmic_Binding_Protein_Type_2 222..583 CDD:304360 85/450 (19%)
Lig_chan 355..602 CDD:278489 53/308 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.