DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and Ir56b

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:473 Identity:90/473 - (19%)
Similarity:168/473 - (35%) Gaps:117/473 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 FDFD---PFAWGGLQ-VIQRLDGEVPYARKVKDLRGYPLRFSMFTDPLMAMPRSPVETAGYQAVD 219
            :.||   .|.:...| |:.:..|  ||...||.. .....:.:|.|.|.::|:..|         
  Fly    16 YSFDIPHAFIFNETQFVVPKFCG--PYMEIVKHF-AEVYHYQLFLDSLESLPKKSV--------- 68

  Fly   220 GVAARVVGEMLNASV--TYVFPEDNESYGRCLPNGNYTGVVSDIVGGHTHFAPNSRFVLDCIWPA 282
             |...::....|.|:  ..:.||:                .||......|..| ...:.:|:   
  Fly    69 -VEQDIISGKYNLSLHGVIIRPEE----------------TSDFFNATQHSYP-LELMTNCV--- 112

  Fly   283 VEVLYPYTRRNLHLVVPASAIQPEYLIFVRVFRRTVW-YLLLVTLLVVVLVFWVMQRLQRRIPR- 345
                          :||.:...|:::..|....:.:| .|.|.|..|.:|:.:|..|......| 
  Fly   113 --------------MVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALLLRYVHWREPGNATRS 163

  Fly   346 --RGVIQFQATWYEILEMFGKTHVGEPAGRLSSFSSMRTFLMGWILFSYVLSTIYFAKLESGFVR 408
              |.|:...|.......|.....:...:.|:..|.:: .::.|:||.:|.||.:....::..|:|
  Fly   164 YTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTL-LYIFGFILTNYHLSHMTAFDMKPVFLR 227

  Fly   409 PSYEEQVDRVDDLVHLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRR 473
            |     :|...||:|..:.|    .::|::...|            |.||:      ||.::...
  Fly   228 P-----IDTWSDLIHSRLRI----VIHDSLLEEL------------RWLPV------YQALLASP 265

  Fly   474 DRRAAFIMRD-----FHARDFLAITYDSQAERPAYHIAREYLRSMICTYILPRGSPFLHRLESLY 533
            .|..|:::..     |:.:..:.|       :|.:|:::.....:.....:...:.|...|....
  Fly   266 SRSYAYVVTQDAWLFFNRQQKVLI-------QPYFHLSKVCFGGLFNALPMASNASFADSLNKFI 323

  Fly   534 SGFLEHGFFEHWRQMDLITRVGASPDAEEFLEDLGDQTDTDSGSNELAIRNKKV-VLTLDILQGA 597
            ....:.|.:.:|                   |:|..:....:|..::.:....| .|.|:....|
  Fly   324 LNVWQAGLWNYW-------------------EELAFRYAEQAGYAKVFLDTYPVEPLNLEFFTTA 369

  Fly   598 FYLWSVGIGISCLGFAVE 615
            :.:.|.||.||.|.|.:|
  Fly   370 WIVLSAGIPISSLAFCLE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 50/282 (18%)
Ir56bNP_611430.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.