DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and GluRIIB

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_523485.3 Gene:GluRIIB / 33789 FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster


Alignment Length:533 Identity:96/533 - (18%)
Similarity:183/533 - (34%) Gaps:127/533 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 ITGRENGTFDFDPFAWGGLQVI--QRLDGEVPYARKVKDLRGYPLRFSMFT---DPLMAMPRSP- 209
            |..:|....||:.......|.:  :||..:..:::|       |:|:::.|   .|..:....| 
  Fly   385 IWNKEFQLVDFEKLRENSTQALKQKRLQNKEDFSQK-------PIRYTVATRVGKPYFSWREEPE 442

  Fly   210 -VETAGYQAVDGVAARVVGEMLNASVTYVF---PEDNESYGRCLPN-GNYTGVVSDIVGGHTHFA 269
             |...|.:..:|.|..:: .||.....:.|   |..:..||....| ..:.|::..::..:....
  Fly   443 GVHYEGNERFEGYAVDLI-YMLAQECKFDFNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIG 506

  Fly   270 PNSRFVLDCIWPAVEVLYPYTRRNLHLV----VPASAIQPEYLIFVRVFRRTVWYLLLVTLLVV- 329
            .....:.......|:...|:.:..:.::    .|..|   :...|:..:...||..:::.:::. 
  Fly   507 ICDLTITQARRSVVDFTVPFMQLGISILSYKEPPPKA---DIYAFLNPYNAEVWLFVMIAMMITA 568

  Fly   330 -VLVF--------W--VMQRLQRRIPRRGVIQF-QATWYEILEMFGKTHVGEPAGRLSSFSSMRT 382
             .|:|        |  .::.:.|.:.|:.:... .|.|..:..|..:.....|.|     ..||.
  Fly   569 FALIFTGRIDQYEWDQPVENVNREMERQNIWHLSNALWLVLGSMLNQGCDLLPRG-----LPMRL 628

  Fly   383 FLMGWILFSYVLSTIYFAKLESGFVRPSYEEQVDRVDDLVHLDVHIYAVTTMYDAVRSALTEHQY 447
            ....|.:|:.::|..|.|||.:..........:..:.|||..:                  :.|:
  Fly   629 LTAFWWIFALLISQTYIAKLAAFITSSKIAGDIGSLHDLVDQN------------------KVQF 675

  Fly   448 GLLENRSRQLPLGIATSYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAYHIAREYLRS 512
            |.:.        |.|||.|.......|.|.|:       ...|:...|:..:.....:.|..|. 
  Fly   676 GTIR--------GGATSVYFSESNDTDNRMAW-------NKMLSFKPDAFTKNNEEGVDRVKLS- 724

  Fly   513 MICTYILPRGSPFLHRLESLYSGFLEHGFFEHWRQMDL-ITRVGAS----------PDAEEFLED 566
                             :..|:..:|....:::.|.:. :|::|.|          |...:|..:
  Fly   725 -----------------KGTYAFLMETTNLQYYVQRNCELTQIGESFGEKHYGIAVPLNADFRSN 772

  Fly   567 LGDQTDTDSGSNEL-AIRNK----------KVVLTLDILQGAFYLWSVG-------IGISCLGFA 613
            |.......|...|| .:|||          ..|.|:|  .|.|.:.|||       :|: .:|..
  Fly   773 LSVGILRLSERGELFKLRNKWFNSNESTCDSNVPTID--DGQFDMDSVGGLFVVLIVGV-VVGLV 834

  Fly   614 VEHAHWFWRRQTL 626
            :..|.:.|..|.:
  Fly   835 IGVAEFLWHVQRI 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 58/313 (19%)
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377 2/7 (29%)
ANF_receptor 41..378 CDD:279440
PBP2_iGluR_Kainate 422..795 CDD:270432 74/432 (17%)
Lig_chan 555..822 CDD:278489 61/324 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.