DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and GluRIIC

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_608557.4 Gene:GluRIIC / 33275 FlyBaseID:FBgn0046113 Length:940 Species:Drosophila melanogaster


Alignment Length:446 Identity:86/446 - (19%)
Similarity:150/446 - (33%) Gaps:114/446 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 GY--QAVDGVAARVVGEMLNASVTYVF-PEDNESYGRC-LPNGNYTGVVSDIVGGHTHFAPNSRF 274
            ||  ..:|.:|..|..|       ||| |..::.||:. .....:.|::.:|:....|.......
  Fly   453 GYAVDLIDAIARHVGFE-------YVFVPVADQQYGKLDKETKQWNGIIGEIINNDAHMGICDLT 510

  Fly   275 VLDCIWPAVEVLYPYTRRNLHLVVPASA-IQPEYLIFVRVFRRTVWYLLLVTLLVVVLVFWVMQR 338
            :......||:...|:.:..:.::...|. ::.....::..|...||..:|:::.|:..:..::.|
  Fly   511 ITQARKTAVDFTVPFMQLGVSILAYKSPHVEKTLDAYLAPFGGEVWIWILISVFVMTFLKTIVAR 575

  Fly   339 LQR----------RIPRRGVIQFQATWYEILEMFGKTHVGEPAGRLSSFSSM------------- 380
            :.:          |.|            |:||...:.|   ..|.|:..|.|             
  Fly   576 ISKMDWENPHPCNRDP------------EVLENQWRIH---NTGWLTVASIMTAGCDILPRSPQV 625

  Fly   381 RTFLMGWILFSYVLSTIYFAKLESGFVRPSYEEQVDRVDDL-----VHLDVHIYAVTTMYDAVRS 440
            |.|...|.:|:.:::..|.|.|.:.......|..:..:.||     |.... ||..:|......|
  Fly   626 RMFEATWWIFAIIIANSYTANLAAFLTSSKMEGSIANLKDLSAQKKVKFGT-IYGGSTYNLLADS 689

  Fly   441 ALTEHQ--YGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAY 503
            ..|.::  :.|:.|..   |........:.|.|.|..|..::        ||..|          
  Fly   690 NETVYRLAFNLMNNDD---PSAYTKDNLEGVDRVRKNRGDYM--------FLMET---------- 733

  Fly   504 HIAREYLRSMIC--------------TYILPRGSPFLHRLESLYSGFLEHGFFEHWRQMDLITRV 554
             ...||.|...|              ...:|.|:.:...|........|.|     ...||..:.
  Fly   734 -TTLEYHREQNCDLRSVGEKFGEKHYAIAVPFGAEYRSNLSVAILKLSERG-----ELYDLKQKW 792

  Fly   555 GASPDAEEFLEDLGDQTDTDSGSNELAIRNKKVVLTLDILQGAFYLWSVGIGISCL 610
            ..:|:|..|     ::.|.|:..:          :|.:.|:|.||....||.|:.|
  Fly   793 WKNPNASCF-----EEPDPDATPD----------MTFEELRGIFYTLYAGILIAFL 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 60/317 (19%)
GluRIICNP_608557.4 PBP1_iGluR_Kainate 26..404 CDD:107377
Periplasmic_Binding_Protein_Type_1 <279..363 CDD:299141
PBP2_iGluR_Kainate 423..794 CDD:270432 72/390 (18%)
Lig_chan 554..828 CDD:278489 62/331 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.