DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and Ir94c

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_732701.2 Gene:Ir94c / 318727 FlyBaseID:FBgn0051423 Length:604 Species:Drosophila melanogaster


Alignment Length:370 Identity:70/370 - (18%)
Similarity:131/370 - (35%) Gaps:105/370 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 PYTRRNLHLVVPASAIQPEYLIFVRVFR-----RTVWYLLL---VTLLVVVLVFWVMQRLQRRIP 344
            |.|..:|.::||.|   |::. |:.|..     :.:..||:   |.:|:..|:.|:..|:..|..
  Fly   274 PNTACSLIVIVPCS---PKWR-FMDVLHKLGVLKLIGCLLIAYAVFVLIETLILWLTHRISGREV 334

  Fly   345 R-------------RGVIQFQATWYEILEMFGKTHVGEPAGRLSSFSSMRTFLMGWILFSYVLST 396
            |             ||::....                |..|.||.|..:.||: ..:|..|.|.
  Fly   335 RLTSLNQLLNPRAFRGILGLPF----------------PEFRRSSISLRQLFLV-ISVFGLVYSN 382

  Fly   397 IYFAKLESGFVRPSYEEQVDRVDDLVHLDVHIYAVTTMYDAVRSALTEH-----------QYGLL 450
            .....|.:...:|:...||....:|....:    :|.|.....|.:.:|           .|.:|
  Fly   383 FVSCTLSALLTKPAQNPQVRNFKELRDSGL----ITIMDKYTHSFIEKHIDPEFFDHVLPHYLIL 443

  Fly   451 ENR-SRQLPLGIATSYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAYHIAREY----- 509
            :.: :.::......||...:.....:....:.:.|..|.|.    :|::...|:::.|.|     
  Fly   444 QKKEALRMIWNFNDSYSYVMYTTTWKSLNTVQKSFDERVFC----ESESLTIAWNLPRMYVLGNN 504

  Fly   510 --LRSMICTYI--LPRGSPFLHRLESLYSGFLEHGFFEHWRQMDLITRVGASPDAEEFLEDLGDQ 570
              |:.|:..||  :|                 :.|..:.|.:.        .|...:.|.::   
  Fly   505 SVLKWMLSRYITYMP-----------------QTGIPDSWTEQ--------LPKVLKLLYNV--- 541

  Fly   571 TDTDSGSNELAIRNKKVVLTLDILQGAFYLWSVGIGISCLGFAVE 615
                  ::...|:...|.|::..|...::|..:|..|:.|.|.||
  Fly   542 ------TSPRRIKEGAVPLSIQHLSWIWHLLFIGESIATLVFIVE 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 51/307 (17%)
Ir94cNP_732701.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.