DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and GluRIIE

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001036733.1 Gene:GluRIIE / 318623 FlyBaseID:FBgn0051201 Length:897 Species:Drosophila melanogaster


Alignment Length:492 Identity:104/492 - (21%)
Similarity:176/492 - (35%) Gaps:122/492 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 LMAMPRSP----VET----AGYQAVDGVAARVVGEMLN-ASVTYVFPEDNESYGRCLPNGN-YTG 256
            |:::|..|    |||    .|....:|....::.|:.: ....:.|......||....:.| .||
  Fly   425 LLSVPNKPYAQLVETYKQLEGNSQYEGYGVDLIKELADKLGFNFTFVNGGNDYGSYNKSTNESTG 489

  Fly   257 VVSDIVGGHTHFAPNSRFVLDCIWPAVEVLYPYTRRNLHLVV----PASAIQPEYLIFVRVFRRT 317
            ::.:|:.|....|.....:......|::...|:  .||.:.:    |..| .||...|:..|...
  Fly   490 MLREIMTGRADLAITDLTITSEREQALDFTIPF--MNLGIAILYLKPQKA-TPELFTFMDPFSEE 551

  Fly   318 VWYLLLVTLLVVVLVFWVMQRLQR----------RIPRRGVIQF---QATWYEILEMFGK-THVG 368
            ||:.|..:.|.|.|.|:::.||..          ..|.....||   .:.|:....:..: :.:|
  Fly   552 VWWFLGFSFLGVSLSFFILGRLSPSEWDNPYPCIEEPEELENQFTLGNSIWFTTGALLQQGSEIG 616

  Fly   369 EPAGRLSSFSSMRTFLMGWILFSYVLSTIYFAKLESGFVRPSYEEQVDRVDDLV-HLDVHIYAV- 431
            ..|      .|.||....|..|:.::.:.|.|.|.:.......:..::.||||. :.|..:|.. 
  Fly   617 PKA------LSTRTVASFWWFFTLIVVSSYTANLAAFLTIEKPQSLINSVDDLADNKDGVVYGAK 675

  Fly   432 ---TTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVR-RRDRRAAFIMRDFHARDFLAI 492
               :|....:.||  |.:|..:.....:.|..:.....:.|.| :.:...||:|      :..:|
  Fly   676 KTGSTRNFFMTSA--EERYKKMNKFMSENPQYLTEDNMEGVNRVKTNTHYAFLM------ESTSI 732

  Fly   493 TYDSQAE-----------RPAYHIAREYLRSMICTYILPRGSPFLHR-------LESLYSGFLEH 539
            .|:::.|           ...|.||..              ..:.||       ||....|.||.
  Fly   733 EYNTKRECNLKKIGDALDEKGYGIAMR--------------KDWPHRGKFNNALLELQEQGVLEK 783

  Fly   540 GFFEHWRQMDLITRVGASPDAEEFLEDLGDQTDTDSGSNELAIRNKKVVLTLDILQGAFYLWSVG 604
            ...:.|.:      ||....|.:  ||..|.|..|                ::.|:|.|::..||
  Fly   784 MKNKWWNE------VGTGICATK--EDAPDATPLD----------------MNNLEGVFFVLLVG 824

  Fly   605 IGISCLG----------FAVEHAHWFWRRQTLRNAVE 631
               ||..          |.::.||.:  |..||:|::
  Fly   825 ---SCCALLYGIISWVLFVMKKAHHY--RVPLRDALK 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 61/311 (20%)
GluRIIENP_001036733.1 PBP1_iGluR_Kainate 42..396 CDD:107377
ANF_receptor 51..382 CDD:279440
PBP2_iGluR_Kainate 419..790 CDD:270432 81/395 (21%)
Lig_chan 551..824 CDD:278489 65/324 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.