DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and GRIN2B

DIOPT Version :10

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_000825.2 Gene:GRIN2B / 2904 HGNCID:4586 Length:1484 Species:Homo sapiens


Alignment Length:31 Identity:9/31 - (29%)
Similarity:16/31 - (51%) Gaps:4/31 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 DTETKNLRRFDIEGMVD----QDDFVRTFFD 361
            |.:...:.|.|:.|.||    :.||::..|:
Human   250 DVDAAYMGRMDLHGKVDSLTQEIDFLQQLFE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 None
GRIN2BNP_000825.2 PBP1_iGluR_NMDA_NR2 33..388 CDD:380601 9/31 (29%)
PBP2_iGluR_NMDA_Nr2 403..803 CDD:270436
Pore-forming. /evidence=ECO:0000250|UniProtKB:A7XY94 604..623
NMDAR2_C 840..1484 CDD:463148
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1074..1097
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1161..1194
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1271..1301
Interaction with DAPK1. /evidence=ECO:0000250|UniProtKB:Q01097 1292..1304
PDZ-binding. /evidence=ECO:0000250 1482..1484
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.