DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and GRIK5

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_011525167.1 Gene:GRIK5 / 2901 HGNCID:4583 Length:982 Species:Homo sapiens


Alignment Length:391 Identity:81/391 - (20%)
Similarity:136/391 - (34%) Gaps:104/391 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 AGYQAVDGVAA---RVVGEMLNASVTYVFPEDNESYGRCLPNGNYTGVVSDI---------VGGH 265
            :|.:..:|...   |.:.|:|.........||. .||...|||::||:|.::         |...
Human   438 SGNERFEGFCVDMLRELAELLRFRYRLRLVEDG-LYGAPEPNGSWTGMVGELINRQKADLAVAAF 501

  Fly   266 THFAPNSRFVLDCIWP----AVEVLYPYTRRNLHLVVPASAIQPEYLIFVRVFRRTVWYLLLVTL 326
            |..|...: |:|...|    .:.:||     .:|:     ..:|.|..|:..|...||..:|:..
Human   502 TITAEREK-VIDFSKPFMTLGISILY-----RVHM-----GRKPGYFSFLDPFSPAVWLFMLLAY 555

  Fly   327 LVVVLVFWVMQRLQ-----------RRIPRRGVIQFQAT-----WYEILEMFGKTHVGEPAGRLS 375
            |.|..|.::..||.           |..|.  :::.|.|     |:.:            .|.:.
Human   556 LAVSCVLFLAARLSPYEWYNPHPCLRARPH--ILENQYTLGNSLWFPV------------GGFMQ 606

  Fly   376 SFS-------SMRTFLMGWILFSYVLSTIYFAKLESGFVRPSYEEQVDRVDDLV------HLDVH 427
            ..|       |.|.....|..|:.::.:.|.|.|.:.......|..|:..|||.      :..:|
Human   607 QGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIH 671

  Fly   428 IYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFI----MRDFHARD 488
            ..:..|.:...|....:..:..::::.   |.....|..:.:.|..:.|.||:    |.::|.|.
Human   672 AGSTMTFFQNSRYQTYQRMWNYMQSKQ---PSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRL 733

  Fly   489 FLAIT-YDSQAERPAYHIAREYLRSMICTYILPRGSPFL-------------HRLESLYSGFLEH 539
            ...:| .....:...|.|.            :|.||||.             :|||.|...:.|.
Human   734 NCNLTQIGGLLDTKGYGIG------------MPLGSPFRDEITLAILQLQENNRLEILKRKWWEG 786

  Fly   540 G 540
            |
Human   787 G 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 47/255 (18%)
GRIK5XP_011525167.1 PBP1_iGluR_Kainate_KA1_2 25..399 CDD:107389
ANF_receptor 42..379 CDD:279440
Periplasmic_Binding_Protein_Type_2 414..785 CDD:304360 79/387 (20%)
Lig_chan 546..816 CDD:278489 53/271 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.