DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and Grin2c

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_036707.3 Gene:Grin2c / 24411 RGDID:2739 Length:1250 Species:Rattus norvegicus


Alignment Length:451 Identity:86/451 - (19%)
Similarity:154/451 - (34%) Gaps:143/451 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 NESYGRCLPNGNYTGVVSDIVGGHTHFAPNSRFVLDCIWPAVEVLYPYTRRNLHLVVPAS--AIQ 304
            |..:|:.: .|.:.|::.::.......|..|..:.:.....::...|:....:.::|..|  .:.
  Rat   493 NGKHGKRV-RGVWNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFVETGISVMVSRSNGTVS 556

  Fly   305 PEYLIFVRVFRRTVWYLLLVTLLVVVLVFWVM----------QRLQRRIPRRGVIQF---QATWY 356
            |.  .|:..:...||.::.|..|.||.:...|          |.|.:. .:.|...|   ::.|.
  Rat   557 PS--AFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTKG-KKPGGPSFTIGKSVWL 618

  Fly   357 EILEMFGKT-HVGEPAGRLSSFSSMRTFLMGWILFSYVLSTIYFAKLESGFVRPSYEEQVDRVDD 420
            ....:|..: .:..|.|..|     :..::.|..|:.:....|.|.|.:..::..|.:.|..:.|
  Rat   619 LWALVFNNSVPIENPRGTTS-----KIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSD 678

  Fly   421 LV----------------------------HLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQL 457
            ..                            :.|:|.:.|.....:|..|||..:.|.|:      
  Rat   679 KKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKMGKLD------ 737

  Fly   458 PLGIATSYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAYHIAREYLRSMICTYILPRG 522
                                |||             ||                :.:..|:  .|
  Rat   738 --------------------AFI-------------YD----------------AAVLNYM--AG 751

  Fly   523 SPFLHRLESLYSG--FLEHGF------FEHW-RQMDLITRVGASPDAEEFLEDLGD------QTD 572
            .....:|.::.||  |...|:      ..|| |.:||           ..|:.|||      :|.
  Rat   752 KDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDL-----------ALLQLLGDGETQKLETV 805

  Fly   573 TDSG--SNELAIRNKKVVLTLDI--LQGAFYLWSVGIGISCLGFAVEHAHWFWRRQTLRNA 629
            ..||  .||   :|:.:...|||  :.|.||:..|.:|::.|.||.||..::..|.::.|:
  Rat   806 WLSGICQNE---KNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVYWKLRHSVPNS 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 61/334 (18%)
Grin2cNP_036707.3 PBP1_iGluR_NMDA_NR2 41..397 CDD:380601
PBP2_iGluR_NMDA_Nr2 413..813 CDD:270436 68/396 (17%)
NMDAR2_C 850..>925 CDD:402274 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.