DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and Samd14

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001351064.1 Gene:Samd14 / 217125 MGIID:2384945 Length:419 Species:Mus musculus


Alignment Length:97 Identity:21/97 - (21%)
Similarity:34/97 - (35%) Gaps:25/97 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PAAEKGDSLVRRILDMLNPHQR-------------------RKHMHKYLFVWPNAGRHQLLRLFR 138
            |:::...|.||| .....||..                   :|...|:|.:.....|....|..:
Mouse   148 PSSDSSPSFVRR-YPRAEPHSEDDSRDASPPEPASPTIGLDKKTRRKFLDLGVTLRRASTSRSRK 211

  Fly   139 GSWAKKLLYG----LAITGRENGTFDFDPFAW 166
            ...:.:|..|    :..:|| .|:..|.||:|
Mouse   212 EKGSNRLSMGSRESVEGSGR-TGSSPFLPFSW 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489
Samd14NP_001351064.1 Herpes_ICP4_C 45..>236 CDD:332854 17/89 (19%)
SAM_Neurabin-like 323..388 CDD:188911
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1945
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.