DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and SAMD3

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001264114.1 Gene:SAMD3 / 154075 HGNCID:21574 Length:544 Species:Homo sapiens


Alignment Length:363 Identity:69/363 - (19%)
Similarity:114/363 - (31%) Gaps:146/363 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 AKLESGFVRPSYEEQ-------------VDRV---------DDLVHL----DVHIYAVTTMYDAV 438
            :||:|  ..||.|:|             |::|         .:|||.    :|...|:..:.|.:
Human     4 SKLQS--PSPSQEKQGVYLQETAMETWSVEQVCSWLVEKNLGELVHRFQEEEVSGAALLALNDRM 66

  Fly   439 RSALTE---HQYGLLE--NRSRQLPLGIATSYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQA 498
            ...|.:   ||..|::  .:.:|...|:.:.       ...::||.:|:...|||:    .|.::
Human    67 VQQLVKKIGHQAVLMDLIKKYKQNTQGLKSP-------ENPKKAALVMQTEAARDY----RDEES 120

  Fly   499 ERPAYH--------------------------------IAREYLRSMICTYILPRGSPF------ 525
            ..||.|                                :||........:|:||. .|:      
Human   121 SSPARHGEQMPSFYPAENLDNGLIDQRVLKQRRNVKQILARSKALQWTKSYVLPE-FPYDVKCML 184

  Fly   526 --------------LHRLESLYSGFLEHGFFEHWRQMDLITRVGASPDAEEFLEDLG-------- 568
                          :..|::..:.:||...:...:|.:.:  |.|...|..||::.|        
Human   185 AEQKCPDHSMRIRIIEFLQADMTKYLEGSLYPSTQQYNDV--VNALLQAHPFLDEDGCGFFLWKR 247

  Fly   569 ------DQTDTDSGSNELAIRNK-----------KVVLTLDILQGAFYLWSVGIGISCLGFAV-E 615
                  .........:|..||||           |.:  .||......|..:.....|....: |
Human   248 ALKDRFKYVRRPIEDDEQVIRNKCKFGHRRGQTRKSL--ADIRFDEIKLVQIKEEAVCFDSELDE 310

  Fly   616 HAHWF----------WRR------QTL---RNAVEART 634
            |..||          ||.      |||   |..:.:||
Human   311 HIKWFQQEYVKTEKDWREIDKRMSQTLEIRRKMIGSRT 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 56/314 (18%)
SAMD3NP_001264114.1 SAM_Samd3 25..90 CDD:188925 12/64 (19%)
SAM 25..89 CDD:197735 12/63 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1945
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.