DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and GRIN3A

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_597702.2 Gene:GRIN3A / 116443 HGNCID:16767 Length:1115 Species:Homo sapiens


Alignment Length:621 Identity:126/621 - (20%)
Similarity:188/621 - (30%) Gaps:206/621 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 FRGSWAKKLLYGLAITGRENGTF----DFDPF---------AWGGLQVI----------QRLDGE 178
            |||......:.|..|...||..|    ..||.         :|.|.:::          ||....
Human   442 FRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTRLGSWQGGKIVMDYGIWPEQAQRHKTH 506

  Fly   179 VPYARK----VKDLRGYPLRFSMFTDPLMAMPRSPVETAGYQAVDGVAARVVGEMLNASVTY--V 237
            ..:..|    |..|..:|..|:...|.....|      ||...:|        .|.|.|.|.  :
Human   507 FQHPSKLHLRVVTLIEHPFVFTREVDDEGLCP------AGQLCLD--------PMTNDSSTLDSL 557

  Fly   238 FPEDNES------------YGRCL---------------------------PNGNYTGVVSDIVG 263
            |...:.|            ||.|:                           .||::||:|.|::.
Human   558 FSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLR 622

  Fly   264 GHTHFAPNSRFVLDCIWPAVEVLYPYTRRNLHLVVPASAIQPEYLIFVRVFRRTVWYLLLVTLLV 328
            |..|.|..|..:.......::...|:...:|.::|...........|:.....|:|..:.|.|.:
Human   623 GTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHI 687

  Fly   329 VVLVFWVMQRLQRRIPRRGVIQFQATWYEILEMFGKTHVGEPAGRLSSFSSM----------RT- 382
            ..:..                    |.||....||.|..|....::.||||.          || 
Human   688 TAVFL--------------------TLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTV 732

  Fly   383 -----------FLMG-WILFSYVLSTIYFAKLESGFV-RPSYEEQVDRVDDLVHLDVHIYAVTTM 434
                       |||. |.:|.....:.|.|.|.:..| ...|||.....|..:|.....:...|:
Human   733 AIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTV 797

  Fly   435 -----YDAVRSALTE-HQYGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFIMRDFHARDFLAIT 493
                 .|.||.:..| |:| :........|.|:......|     ::..|||| |....|: .::
Human   798 RESSAEDYVRQSFPEMHEY-MRRYNVPATPDGVEYLKNDP-----EKLDAFIM-DKALLDY-EVS 854

  Fly   494 YDSQAE-----RP----AYHIAREYLRSMICTYILPRGSPFLHRLESLYSGFLEHGFFEHWRQMD 549
            .|:..:     :|    .|.|.            ||..||....:..|.|.:..|||      ||
Human   855 IDADCKLLTVGKPFAIEGYGIG------------LPPNSPLTANISELISQYKSHGF------MD 901

  Fly   550 LI----TRVGASPDAEEFLEDLGDQTDTDSGSNELAIRNKKVVLTLDILQGAFYLWSVGIGISCL 610
            ::    .||                  ...|....|: .:.:.:.:....|.|.|..:|.|:|.|
Human   902 MLHDKWYRV------------------VPCGKRSFAV-TETLQMGIKHFSGLFVLLCIGFGLSIL 947

  Fly   611 GFAVEH----------------AHWFWRRQTLRNAV 630
            ....||                .:|....|.|..|:
Human   948 TTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRLHRAI 983

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 66/316 (21%)
GRIN3ANP_597702.2 PBP1_iGluR_NMDA_NR3 30..497 CDD:107372 12/54 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..118
ANF_receptor 127..469 CDD:279440 8/26 (31%)
PBP2_iGluR_NMDA_Nr3 512..908 CDD:270438 95/455 (21%)
Lig_chan 676..942 CDD:278489 69/330 (21%)
PPP2CB binding site. /evidence=ECO:0000250 951..987 6/33 (18%)
GIT1-binding. /evidence=ECO:0000250|UniProtKB:Q9R1M7 1062..1095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.