powered by:
Protein Alignment yps and AT1G75560
DIOPT Version :9
Sequence 1: | NP_524033.2 |
Gene: | yps / 39377 |
FlyBaseID: | FBgn0022959 |
Length: | 352 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001077828.1 |
Gene: | AT1G75560 / 843892 |
AraportID: | AT1G75560 |
Length: | 257 |
Species: | Arabidopsis thaliana |
Alignment Length: | 34 |
Identity: | 10/34 - (29%) |
Similarity: | 14/34 - (41%) |
Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 287 RRNFNNGPPPPRRDGGEYIQGQGPPRPQQPRPRR 320
|..|.:..|..||...|.:.....|..::..|||
plant 16 RDRFRSRSPRDRRMRSERVSYHDAPSRREREPRR 49
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.