DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and AT1G75560

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001077828.1 Gene:AT1G75560 / 843892 AraportID:AT1G75560 Length:257 Species:Arabidopsis thaliana


Alignment Length:34 Identity:10/34 - (29%)
Similarity:14/34 - (41%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 RRNFNNGPPPPRRDGGEYIQGQGPPRPQQPRPRR 320
            |..|.:..|..||...|.:.....|..::..|||
plant    16 RDRFRSRSPRDRRMRSERVSYHDAPSRREREPRR 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729
AT1G75560NP_001077828.1 PTZ00368 55..172 CDD:173561
PTZ00368 114..247 CDD:173561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.