DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and Lin28a

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_665832.1 Gene:Lin28a / 83557 MGIID:1890546 Length:209 Species:Mus musculus


Alignment Length:150 Identity:49/150 - (32%)
Similarity:65/150 - (43%) Gaps:38/150 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGFINRN 81
            |::.||:.  ||:      .....||.|...|              .|..|||||:.|:||::..
Mouse    17 AEKAPEEA--PPD------AARAADEPQLLHG--------------AGICKWFNVRMGFGFLSMT 59

  Fly    82 -------DTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGS 139
                   |...|||||||.:    ..:..||:.:||.|||......||.|:..||||.|....||
Mouse    60 ARAGVALDPPVDVFVHQSKL----HMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS 120

  Fly   140 QFAADKRRNFRPWMKKNRRK 159
            : ...|.:|    |:|.|.|
Mouse   121 E-RRPKGKN----MQKRRSK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 29/75 (39%)
Lin28aNP_665832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 5/21 (24%)
CSP_CDS 42..111 CDD:239905 28/72 (39%)
Flexible linker 113..136 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.