DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and GRP2

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_195580.1 Gene:GRP2 / 830024 AraportID:AT4G38680 Length:203 Species:Arabidopsis thaliana


Alignment Length:276 Identity:78/276 - (28%)
Similarity:96/276 - (34%) Gaps:112/276 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGN-EAAN 127
            |:||||:.:.|:|||..:|..:|:|||||:|.    .:..||:...|.|||:|.|..... :|.:
plant    13 GSVKWFDTQKGFGFITPDDGGDDLFVHQSSIR----SEGFRSLAAEEAVEFEVEIDNNNRPKAID 73

  Fly   128 VTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAAPIVDGQPQQQVQ 192
            |:||.|.||:|:....                                                .
plant    74 VSGPDGAPVQGNSGGG------------------------------------------------S 90

  Fly   193 SGPRQPRQNFRRGPPGGPPGGPRGGPRGPPGGAPGGPRRYNNYYLRQPRRGLGGGDGS-----AE 252
            ||.|            |..||.|||.||..||..||...|..       ||.||..||     .|
plant    91 SGGR------------GGFGGGRGGGRGSGGGYGGGGGGYGG-------RGGGGRGGSDCYKCGE 136

  Fly   253 PG--VHDQNPEGLQRGEGQGPRRGGGPPGGPQRRFFRRNFNNGPPPPRRDGGEYIQGQGPPRPQQ 315
            ||  ..|.:..|...|.|.|...|||..||                   .||.|  |.|      
plant   137 PGHMARDCSEGGGGYGGGGGGYGGGGGYGG-------------------GGGGY--GGG------ 174

  Fly   316 PRPRRQRKPNGPGGGS 331
                  .:..|.||||
plant   175 ------GRGGGGGGGS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 27/67 (40%)
GRP2NP_195580.1 CSD 11..77 CDD:278729 27/67 (40%)
PTZ00368 131..>201 CDD:173561 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I2512
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100504
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.