DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and CSDP1

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001320149.1 Gene:CSDP1 / 829758 AraportID:AT4G36020 Length:299 Species:Arabidopsis thaliana


Alignment Length:253 Identity:73/253 - (28%)
Similarity:91/253 - (35%) Gaps:93/253 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKG- 122
            |.:.||.|.|||...|||||..:|...::|||||:|.    .:..||:..|:.|||.:..|..| 
plant     8 AARSTGKVNWFNASKGYGFITPDDGSVELFVHQSSIV----SEGYRSLTVGDAVEFAITQGSDGK 68

  Fly   123 NEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAAPIVDGQP 187
            .:|.|||.|.|    ||.    |:.|       |.|.:|.                         
plant    69 TKAVNVTAPGG----GSL----KKEN-------NSRGNGA------------------------- 93

  Fly   188 QQQVQSGPRQPRQNFRRGPPGGPPG-------GPRGGPRGPPGGAPGGPRR-------YN----N 234
                           |||  ||..|       |......|..||..||.||       ||    .
plant    94 ---------------RRG--GGGSGCYNCGELGHISKDCGIGGGGGGGERRSRGGEGCYNCGDTG 141

  Fly   235 YYLRQ-------PRRGL--GGGDGSAEPG-VHDQNPEGLQRGEGQGPRRG---GGPPG 279
            ::.|.       .:||.  ||.||....| |.....:..|:..|.|.:||   ||..|
plant   142 HFARDCTSAGNGDQRGATKGGNDGCYTCGDVGHVARDCTQKSVGNGDQRGAVKGGNDG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 30/69 (43%)
CSDP1NP_001320149.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.