DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and GRP2B

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_179702.1 Gene:GRP2B / 816641 AraportID:AT2G21060 Length:201 Species:Arabidopsis thaliana


Alignment Length:273 Identity:82/273 - (30%)
Similarity:98/273 - (35%) Gaps:117/273 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGN-EAAN 127
            ||||||:.:.|:|||..:|..:|:|||||:|.    .:..||:...|.|||||.:...|. :|..
plant    17 GTVKWFDTQKGFGFITPSDGGDDLFVHQSSIR----SEGFRSLAAEESVEFDVEVDNSGRPKAIE 77

  Fly   128 VTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAAPIVDGQPQQQVQ 192
            |:||.|.||:|:                        .|....|..                    
plant    78 VSGPDGAPVQGN------------------------SGGGGSSGG-------------------- 98

  Fly   193 SGPRQPRQNFRRGPPGGPPGGPRGGPRGPPGGAPGGPRRYNNYYLR-QPRRGLGGGDGS----AE 252
                       ||..||  ||.|||.||  ||:.||     .|..| ...||.||||.|    .|
plant    99 -----------RGGFGG--GGGRGGGRG--GGSYGG-----GYGGRGSGGRGGGGGDNSCFKCGE 143

  Fly   253 PGVHDQNPEGLQRGEGQGPRRGGGPPGGPQRRFFRRNFNNGPPPPRRDGGEYIQGQGPPRPQQPR 317
            || |      :.|...||   |||..||                  ..||.|..|.|        
plant   144 PG-H------MARECSQG---GGGYSGG------------------GGGGRYGSGGG-------- 172

  Fly   318 PRRQRKPNGPGGG 330
                   .|.|||
plant   173 -------GGGGGG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 29/67 (43%)
GRP2BNP_179702.1 CSD 15..81 CDD:278729 29/67 (43%)
zf-CCHC 136..153 CDD:278525 6/23 (26%)
zf-CCHC 182..197 CDD:278525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I2512
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100504
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.