DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and CSP3

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_565427.1 Gene:CSP3 / 816297 AraportID:AT2G17870 Length:301 Species:Arabidopsis thaliana


Alignment Length:255 Identity:74/255 - (29%)
Similarity:94/255 - (36%) Gaps:74/255 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKG- 122
            |.:..|.|.||:...|||||..:|..|::|||||:|..:    ..||:..||.||:::.:|..| 
plant     8 AARSIGKVSWFSDGKGYGFITPDDGGEELFVHQSSIVSD----GFRSLTLGESVEYEIALGSDGK 68

  Fly   123 NEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEV----------------EGEDAESS 171
            .:|..||.|.|    ||   .:|:.|.......|....|||                .|.....|
plant    69 TKAIEVTAPGG----GS---LNKKENSSRGSGGNCFNCGEVGHMAKDCDGGSGGKSFGGGGGRRS 126

  Fly   172 AQQQQQQAAPIVDGQPQQQVQSGPRQPRQNFRRGPPGGPPGGPRGGPR-----GPPG-------G 224
            ..:.:......|....:...|||             ||..||..||.|     |..|       |
plant   127 GGEGECYMCGDVGHFARDCRQSG-------------GGNSGGGGGGGRPCYSCGEVGHLAKDCRG 178

  Fly   225 APGGPRRYNNYYLRQPRRGLGGGDGSAEPGVHDQNPEGLQRGEGQGPR----RGGGPPGG 280
            ..||    |.|       |.|||.||...|.:      :..|.|...|    .|||..||
plant   179 GSGG----NRY-------GGGGGRGSGGDGCY------MCGGVGHFARDCRQNGGGNVGG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 28/69 (41%)
CSP3NP_565427.1 CSD 13..77 CDD:278729 28/67 (42%)
PTZ00368 132..299 CDD:173561 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.