DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and lin28aa

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_017206944.1 Gene:lin28aa / 799825 ZFINID:ZDB-GENE-110914-157 Length:193 Species:Danio rerio


Alignment Length:195 Identity:59/195 - (30%)
Similarity:82/195 - (42%) Gaps:42/195 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DELQGQQGQPAP-PTKEVIATKVTGTVKWFNVKSGYGFINRN-------DTREDVFVHQSAIARN 97
            :|.:||..:..| |...|      |..|||||:.|:||::.|       :|..|||||||.:   
Zfish    10 EEEEGQAAEEDPRPYHGV------GVCKWFNVRMGFGFLSMNTRDGVPLETPVDVFVHQSKL--- 65

  Fly    98 NPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKD-- 160
             ..:..||:.:||.|||......||.|:..||||.|....||    |:|...:...|:..:.|  
Zfish    66 -HMEGFRSLKEGESVEFTFKKSSKGLESVRVTGPGGAHCVGS----DRRPKGKSVQKRRAKGDRC 125

  Fly   161 ---GEVEGEDAESSAQQQQ------QQAAPIVDGQP---QQQVQ------SGPRQPRQNFRRGPP 207
               |.::....|.....|.      |..|.:|...|   ||..|      :|.:|...:....||
Zfish   126 YNCGGLDHHAKECKLPPQPKRCHFCQSVAHMVANCPVKAQQSTQGSQGKSAGQKQEEADQNHSPP 190

  Fly   208  207
            Zfish   191  190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 30/75 (40%)
lin28aaXP_017206944.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.