DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and ybx3

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001015855.1 Gene:ybx3 / 548572 XenbaseID:XB-GENE-1007558 Length:248 Species:Xenopus tropicalis


Alignment Length:259 Identity:114/259 - (44%)
Similarity:139/259 - (53%) Gaps:63/259 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LDELQGQQGQPAPP-------------TKEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQ 91
            :.|:..::.:|..|             .::|:||||.||||||||::||||||||||:|||||||
 Frog     1 MSEVTAEEPKPKTPGAEASSPSASSEIERKVLATKVQGTVKWFNVRNGYGFINRNDTKEDVFVHQ 65

  Fly    92 SAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKN 156
            :||.:|||:|.:||||||||||||||.||||.||||||||.|.||:||::|||:||..|.:.  .
 Frog    66 TAIKKNNPRKYLRSVGDGEVVEFDVVAGEKGAEAANVTGPKGAPVQGSRYAADRRRYRRGYY--G 128

  Fly   157 RRKDGEVEGEDAESSAQQQQQQAAPIVDGQPQQ-QVQSGPRQP---RQNFRRGPPGGPPGGPRGG 217
            ||:....||.|.|            |.||.|:. |.|...|||   |..:||         |...
 Frog   129 RRRGPPREGGDGE------------IKDGVPEMVQTQQINRQPAGYRPRYRR---------PMNQ 172

  Fly   218 PRG-PPGG------------AP--------GGPRRYNNYYLRQPRRGLGGGDGSAEPGVHDQNP 260
            ||. ||.|            ||        |..|.||  |.|:|..|.....||.|.....:.|
 Frog   173 PRSIPPTGEMENKENQNETAAPDQQQLNRRGFRRPYN--YRRRPNPGTAPAQGSKESTKMSETP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 56/68 (82%)
ybx3NP_001015855.1 CSD 36..105 CDD:278729 56/68 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5576
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 184 1.000 Inparanoid score I3825
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 1 1.000 - - otm48843
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5264
SonicParanoid 1 1.000 - - X470
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.