DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and lin28a

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001016266.1 Gene:lin28a / 548523 XenbaseID:XB-GENE-491384 Length:195 Species:Xenopus tropicalis


Alignment Length:109 Identity:41/109 - (37%)
Similarity:56/109 - (51%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TGTVKWFNVKSGYGFINRN-------DTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGE 120
            :|..|||||:.|:||:...       :|..|||||||.:    ..:..||:.:||.|||......
 Frog    35 SGVCKWFNVRMGFGFLTMTKKEGTDLETPVDVFVHQSKL----HMEGFRSLKEGESVEFTFKKSS 95

  Fly   121 KGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMK--KNRRKDGE 162
            ||.|:..||||.|.|..||:        .||.:|  :.||:.|:
 Frog    96 KGLESTRVTGPGGAPCIGSE--------RRPKVKGQQKRRQKGD 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 29/74 (39%)
lin28aNP_001016266.1 CSP_CDS 36..105 CDD:239905 28/72 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..126 12/35 (34%)
Flexible linker. /evidence=ECO:0000250 107..130 9/30 (30%)
PTZ00368 <124..176 CDD:173561 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..195
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.