DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and Carhsp1

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006522410.1 Gene:Carhsp1 / 52502 MGIID:1196368 Length:174 Species:Mus musculus


Alignment Length:106 Identity:26/106 - (24%)
Similarity:37/106 - (34%) Gaps:29/106 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AEQQQAQQQPEQQQNPP----------NPQEQDHEQEPLDELQGQQGQ--PAP-PTKEVIATKVT 63
            |....:.:.|.....||          .|:.:|....||      :|.  |:| ||:.......|
Mouse    23 ARSAMSSEPPPPPLQPPTHQTSVGLLDTPRTRDRSPSPL------RGNVVPSPLPTRRTRTFSAT 81

  Fly    64 ----------GTVKWFNVKSGYGFINRNDTREDVFVHQSAI 94
                      |..|.|....|:|||...|...|:|:|.|.:
Mouse    82 VRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDV 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 13/43 (30%)
Carhsp1XP_006522410.1 CSP_CDS 90..155 CDD:239905 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.