DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and Lin28a

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001102739.1 Gene:Lin28a / 500562 RGDID:1566408 Length:209 Species:Rattus norvegicus


Alignment Length:165 Identity:51/165 - (30%)
Similarity:63/165 - (38%) Gaps:50/165 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADAAESKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTV 66
            |.|||..|..|....|:...|.|.                 |.|                 .|..
  Rat    14 AKAAEKAPEEAPADAARAADEPQL-----------------LHG-----------------AGIC 44

  Fly    67 KWFNVKSGYGFINRN-------DTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNE 124
            |||||:.|:||::..       |...|||||||.:    ..:..||:.:||.|||......||.|
  Rat    45 KWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKL----HMEGFRSLKEGEAVEFTFKKSAKGLE 105

  Fly   125 AANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRK 159
            :..||||.|....||:     ||.....|:|.|.|
  Rat   106 SIRVTGPGGVFCIGSE-----RRPKGKSMQKRRSK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 29/75 (39%)
Lin28aNP_001102739.1 CSD 42..112 CDD:278729 29/73 (40%)
AIR1 <120..>183 CDD:227414 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.