DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and LIN28B

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006715540.2 Gene:LIN28B / 389421 HGNCID:32207 Length:269 Species:Homo sapiens


Alignment Length:276 Identity:70/276 - (25%)
Similarity:103/276 - (37%) Gaps:60/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGF-- 77
            |:..:...|..:.|....:...:||     |:..:||....:|:  :.||..|||||:.|:||  
Human     9 QKRMRSFNQVSSAPGGASKGGGEEP-----GKLPEPAEEESQVL--RGTGHCKWFNVRMGFGFIS 66

  Fly    78 -INRN----DTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVR 137
             |||.    |...|||||||.:.    .:..||:.:||.|||......||.|:..||||.|.|..
Human    67 MINREGSPLDIPVDVFVHQSKLF----MEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCL 127

  Fly   138 GSQFAADKRRNFRPWMKKNRRKD-----GEVEGEDAESSAQQQQ------QQAAPIVDGQPQQQV 191
            ||    ::|...:...|:..:.|     |.::....|.|...|.      |....:|...|.:.|
Human   128 GS----ERRPKGKTLQKRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVANCPHKNV 188

  Fly   192 QSGPRQPRQNFRRGPPGGPPGGPRGGPRGPPGGAPGGPRRYNNYYLRQPRRGLGGGDGSAEPGVH 256
            ..                           ||..:.|.....:........|.:|||.|...|...
Human   189 AQ---------------------------PPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFP 226

  Fly   257 DQNPEGLQRGEGQGPR 272
            .:....:....|:.|:
Human   227 QEARAEISERSGRSPQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 33/75 (44%)
LIN28BXP_006715540.2 CSP_CDS 50..120 CDD:239905 32/73 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.