DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and lin-28

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster


Alignment Length:209 Identity:52/209 - (24%)
Similarity:77/209 - (36%) Gaps:67/209 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGF 77
            |::...|......||.|                    .|.||:|....:: |..|||||..|:||
  Fly    11 ERRTTSQSSTSSANPAN--------------------LASPTEECGCVRL-GKCKWFNVAKGWGF 54

  Fly    78 INRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFA 142
            :..||..::||||||.|..:    ..||:|:.|.|||:.....:|.||..|:...|...:||.:.
  Fly    55 LTPNDGGQEVFVHQSVIQMS----GFRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYR 115

  Fly   143 ADKRRNFR---------------------PWMKKNRRKDGE---------------------VEG 165
            ....|..|                     |..|:..|..||                     :..
  Fly   116 PRINRRTRRMRCYNCGEFANHIASECALGPQPKRCHRCRGEDHLHADCPHKNVTQSHSNSKSISN 180

  Fly   166 EDAESSAQQQQQQA 179
            ..:.|:||::.::|
  Fly   181 NSSSSAAQEKSEEA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 29/68 (43%)
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 28/63 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456390
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.