DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and Lin28b

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_011241482.1 Gene:Lin28b / 380669 MGIID:3584032 Length:303 Species:Mus musculus


Alignment Length:165 Identity:53/165 - (32%)
Similarity:69/165 - (41%) Gaps:35/165 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QQAQQQPEQQQNPPNPQEQDHEQEPL-----DELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSG 74
            |:..:...|..:.|....:..|.|.|     ||.|...|              ||..|||||:.|
Mouse    22 QKMMRSFNQGSSAPGGASKGEEPEKLPGLAEDEPQVLHG--------------TGHCKWFNVRMG 72

  Fly    75 YGFI-------NRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPS 132
            :|||       |..|...|||||||.:.    .:..||:.:||.|||......||.|:..||||.
Mouse    73 FGFISMISREGNPLDIPVDVFVHQSKLF----MEGFRSLKEGEPVEFTFKKSPKGLESIRVTGPG 133

  Fly   133 GEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGED 167
            |.|..||:     ||.....::|.:.|......:|
Mouse   134 GSPCLGSE-----RRPKGKTLQKRKPKGDRWRRQD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 32/75 (43%)
Lin28bXP_011241482.1 CSP_CDS 61..131 CDD:239905 31/73 (42%)
PTZ00368 <183..219 CDD:173561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.