DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and Carhsp1

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_038941233.1 Gene:Carhsp1 / 260416 RGDID:708415 Length:225 Species:Rattus norvegicus


Alignment Length:156 Identity:40/156 - (25%)
Similarity:53/156 - (33%) Gaps:56/156 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 AQQQQQQAAPIVDGQPQQQVQSGPRQPRQNFRRGPPGGPPGGPRGGPRGPPGGAPG------GPR 230
            :|.|.|..|.:|.|       || |.|.::                |.|||..|||      .|.
  Rat    45 SQSQGQVGARLVLG-------SG-RHPLRD----------------PIGPPSRAPGPHWASADPL 85

  Fly   231 RYNNYYLRQPRRGLGGGDGSAEPGVHDQNPEGLQRGEGQGPRRGGGPPGGPQRRFFRRNFNNGPP 295
            ....:.|..|...|      |.||:.::.|..     ...||  ...|.||.:           .
  Rat    86 GVGEHLLSLPSPAL------ASPGLQNKGPVA-----AAAPR--SSYPAGPVQ-----------A 126

  Fly   296 PPRRDGGEYIQGQGPPRP--QQPRPR 319
            |.|...|..::|..|..|  |:|||:
  Rat   127 PGRASIGPELKGAWPHTPPCQRPRPQ 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729
Carhsp1XP_038941233.1 PHA03247 <63..169 CDD:223021 31/130 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.