DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and cey-4

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_499393.1 Gene:cey-4 / 176516 WormBaseID:WBGene00000475 Length:294 Species:Caenorhabditis elegans


Alignment Length:325 Identity:94/325 - (28%)
Similarity:121/325 - (37%) Gaps:117/325 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QGQQG---QPAPP-------------TKEVIATKVTGTVKWFNVKSGYGFINRN---DTREDVFV 89
            :|:.|   ||.||             :|:||.|.|.|.||||:|:..|||:.|:   |..||.||
 Worm    55 RGRGGHFYQPRPPYEDQMKKLEEDLASKKVIETGVKGHVKWFSVRGRYGFVARDKPTDENEDFFV 119

  Fly    90 HQSAIARNNP-KKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAADKRRNFRPWM 153
            ||:||.:::. |..:|::.|.|.|.||:|.|.||.||||||||.||.||||:||.....::|   
 Worm   120 HQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSRFARTLLTHWR--- 181

  Fly   154 KKNRRKDGEVEGEDAESSAQQQQQQAAPIVDGQPQQQVQSGPRQPRQNFRRGPPGGPPGGPRGGP 218
                                                             .||         |||.
 Worm   182 -------------------------------------------------TRG---------RGGA 188

  Fly   219 RGPPGGAPGGPRRYNNYYLRQPRRGLGGGDGSAEPGVHD--QNPEGLQRGEGQGPRRGGGPPGGP 281
            ||..|...|.||:..:.          .||...|....|  :|       .|.|..||.      
 Worm   189 RGRGGRGRGAPRQTRDQ----------DGDEKDEKEKSDTIEN-------SGDGETRGK------ 230

  Fly   282 QRRFFRRNFNNGPPPPRRDGGEYIQGQGPPRPQQPRP------RRQRKPNGPGGGSEQQPEKNGA 340
                 ||...:|...|....||...|..........|      :||||.|.....:.:|.|:..|
 Worm   231 -----RRTRRHGKLQPDAPSGEKGDGDAAAATTDAAPAAEKKKKRQRKGNKEPTTTTEQKEETAA 290

  Fly   341  340
             Worm   291  290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 37/72 (51%)
cey-4NP_499393.1 CSD 89..162 CDD:278729 37/72 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162207
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11544
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X470
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.