DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and lin-28

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001021085.1 Gene:lin-28 / 172626 WormBaseID:WBGene00003014 Length:227 Species:Caenorhabditis elegans


Alignment Length:211 Identity:57/211 - (27%)
Similarity:91/211 - (43%) Gaps:69/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NPPNPQEQDHEQEP------LDE---LQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGFINRN 81
            |..:||::..::.|      |.|   :...:..|:|      ..:..|:.|||||..||||:..:
 Worm    14 NRYSPQDEVEDRLPDVVDNRLTENMRVPSFERLPSP------TPRYFGSCKWFNVSKGYGFVIDD 72

  Fly    82 DTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGE----KGNEAANVTGP-SGEPVRGS-- 139
            .|.||:|||||    |...:..||:.:||.|.:  .|.|    ||.||..|:|. .|:.::||  
 Worm    73 ITGEDLFVHQS----NLNMQGFRSLDEGERVSY--YIQERSNGKGREAYAVSGEVEGQGLKGSRI 131

  Fly   140 -----------------QFAADKRRNFRPWMK--------------------KNRRK--DGEVEG 165
                             :||..|.::. |.:|                    :.|||  ..:|..
 Worm   132 HPLGRKKAVSLRCFRCGKFATHKAKSC-PNVKTDAKVCYTCGSEEHVSSICPERRRKHRPEQVAA 195

  Fly   166 EDAESSAQQQQQQAAP 181
            |:|| :|:...::::|
 Worm   196 EEAE-AARMAAEKSSP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 31/72 (43%)
lin-28NP_001021085.1 CSD 55..119 CDD:278729 31/69 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.