DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and cey-2

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_491645.1 Gene:cey-2 / 172219 WormBaseID:WBGene00000473 Length:267 Species:Caenorhabditis elegans


Alignment Length:209 Identity:73/209 - (34%)
Similarity:119/209 - (56%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAD----AAESKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATK 61
            |:|    |.|....|.||:..:...:.:..|.|.:|:..::......:.:..:....:|..|.|.
 Worm     1 MSDTANAAVEIGEEALEQKLEELSVQDKTTPSNSEEKMRKRRLPTAERIRLWEEEQKSKTAITTG 65

  Fly    62 VTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKK-AVRSVGDGEVVEFDVVIGEKGNEA 125
            :.|.|||::|...||||:|||..:|:||||:|||::..:| .:|::||.|.|.||:|.|:.|.||
 Worm    66 LQGKVKWYSVLRRYGFISRNDGEKDIFVHQTAIAKSATEKFYLRTLGDDEEVLFDLVEGKNGPEA 130

  Fly   126 ANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAAPIVDGQPQQQ 190
            ||||||:|:.|.||::.......||    |||:....|:||:::|:..:.|:.:|   |.:.:: 
 Worm   131 ANVTGPNGDNVIGSRYRHKLLSRFR----KNRKPRASVDGEESQSTDAKPQEMSA---DAEKKK- 187

  Fly   191 VQSGPRQPRQNFRR 204
                ||:.|:|..|
 Worm   188 ----PRKQRKNRNR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 37/69 (54%)
cey-2NP_491645.1 CSD 66..136 CDD:278729 37/69 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162205
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100504
Panther 1 1.100 - - O PTHR11544
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X470
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.