DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and cey-3

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001367859.1 Gene:cey-3 / 172211 WormBaseID:WBGene00000474 Length:265 Species:Caenorhabditis elegans


Alignment Length:212 Identity:67/212 - (31%)
Similarity:118/212 - (55%) Gaps:16/212 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADAAESKPLAAEQQQAQQQPE-----QQQNPPNPQEQDHEQEPLDELQ-GQQGQPAPPTKEVIA 59
            |:|.|.: .:..::|..:::.:     ::::|.......|.....:.:: .::.|.|   |.|:.
 Worm     1 MSDTANT-AVEVDEQVIEKKLDDLSIGKKRSPSKDDTSKHRLPAAERIRIWEEEQKA---KIVLT 61

  Fly    60 TKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKK-AVRSVGDGEVVEFDVVIGEKGN 123
            ..:.|.|||::|...||||:|:|..:||||||:||::::.:| .:|::.|.|.|.||:|.|:.|.
 Worm    62 AGLQGKVKWYSVLRRYGFISRSDGEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGP 126

  Fly   124 EAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAAPIVDGQPQ 188
            ||||||||:|..|.||::.......||    || ||...|.|||.:|...::..:|..:...:.:
 Worm   127 EAANVTGPAGVNVSGSKYRHQLLSRFR----KN-RKPKIVVGEDFDSKETEKLVEAPAVAMEKKK 186

  Fly   189 QQVQSGPRQPRQNFRRG 205
            |:.|...:..:|..::|
 Worm   187 QRKQRKNKNRKQKDQKG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 35/69 (51%)
cey-3NP_001367859.1 CSD 64..134 CDD:278729 35/69 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162206
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100504
Panther 1 1.100 - - O PTHR11544
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X470
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.