DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and Csdc2

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_663448.2 Gene:Csdc2 / 105859 MGIID:2146027 Length:154 Species:Mus musculus


Alignment Length:105 Identity:29/105 - (27%)
Similarity:39/105 - (37%) Gaps:32/105 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PAP-PTKEVIATKVT----------GTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAV 103
            |:| |||.......|          |..|.|:...|:|||...:..||:|||.|.|         
Mouse    47 PSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDI--------- 102

  Fly   104 RSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAA 143
                :||.|..:      |:|......|.  |.:..:|.|
Mouse   103 ----EGEYVPVE------GDEVTYKICPI--PPKNQKFQA 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 20/78 (26%)
Csdc2NP_663448.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..62 5/14 (36%)
CSP_CDS 71..135 CDD:239905 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.