Sequence 1: | NP_524033.2 | Gene: | yps / 39377 | FlyBaseID: | FBgn0022959 | Length: | 352 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001135490.1 | Gene: | lin28b / 100216028 | XenbaseID: | XB-GENE-1218969 | Length: | 253 | Species: | Xenopus tropicalis |
Alignment Length: | 268 | Identity: | 66/268 - (24%) |
---|---|---|---|
Similarity: | 99/268 - (36%) | Gaps: | 108/268 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 AEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYG 76
Fly 77 FINRNDTRE--------DVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSG 133
Fly 134 EPVRGSQ-----FAADKRR-------------------NFRPWMKK------------------- 155
Fly 156 --------------------NRRKDGEV-----------EG--EDAESSAQQQQQQAAPIVDGQP 187
Fly 188 QQQVQSGP 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
yps | NP_524033.2 | CSD | 62..131 | CDD:278729 | 31/76 (41%) |
lin28b | NP_001135490.1 | CSP_CDS | 35..104 | CDD:239905 | 30/73 (41%) |
PTZ00368 | <123..168 | CDD:173561 | 6/44 (14%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1604809at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000228 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |