DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yps and ybx2

DIOPT Version :9

Sequence 1:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001123667.1 Gene:ybx2 / 100170415 XenbaseID:XB-GENE-5798907 Length:337 Species:Xenopus tropicalis


Alignment Length:357 Identity:137/357 - (38%)
Similarity:178/357 - (49%) Gaps:68/357 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGFINRN 81
            ::.:|.:.:....|:.....|:|.......|     |.|:|:||:|.||||||||::||||||||
 Frog     2 SEAEPREPEPVLEPESAPEIQKPTISAARNQ-----PNKKVLATQVQGTVKWFNVRNGYGFINRN 61

  Fly    82 DTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAADKR 146
            ||:|||||||:||.||||:|.:|||||||.||||||.||||.||||||||.|.||:||:||.::|
 Frog    62 DTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRFAPNRR 126

  Fly   147 RNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAAPIVDGQPQQQVQSGPRQP-----RQNFRRGP 206
            |..|.:.:......||..||..   :.:|..:.....:|.||||.:...|:|     |:.|||||
 Frog   127 RFRRRFYRPRADTAGESGGEGV---SPEQMSEGERGEEGSPQQQQRPQRRRPPPFFYRRRFRRGP 188

  Fly   207 PGGPPGGPRGG-----------PRGPPG--GAPGG------PRRYNNYYLR--QPRRGLGGGDGS 250
              .||.....|           |..|..  .|.|.      |||:...:.|  :||         
 Frog   189 --RPPNQQSQGSEANDQSENKDPAAPVSEVSASGDDQQRPPPRRFRQRFRRPFRPR--------- 242

  Fly   251 AEPGVHDQNPEGLQRGEGQGPRR--GGGPPGGPQRR----FFRRNFNNGPPPPRRDGGEYIQGQG 309
            ..|   .|.|||   |:|: |:.  |.||...|||:    :|:|....|..|.:...    ||.|
 Frog   243 PSP---QQTPEG---GDGE-PKAAPGEGPRPEPQRQRTRPYFQRRRRQGAAPVQPTA----QGDG 296

  Fly   310 PPRPQQPRPRRQRKP-----NGPGGGSEQQPE 336
            ...|.| .|..:..|     :|........||
 Frog   297 KAEPTQ-HPVSEGPPADSPTDGDAADQTSAPE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ypsNP_524033.2 CSD 62..131 CDD:278729 56/68 (82%)
ybx2NP_001123667.1 CSD 42..111 CDD:278729 56/68 (82%)
PRK07764 <193..336 CDD:236090 39/156 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5576
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 184 1.000 Inparanoid score I3825
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 1 1.000 - - otm48843
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X470
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.