Sequence 1: | NP_001303392.1 | Gene: | CG11560 / 39376 | FlyBaseID: | FBgn0036249 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648546.1 | Gene: | ssp / 39375 | FlyBaseID: | FBgn0036248 | Length: | 368 | Species: | Drosophila melanogaster |
Alignment Length: | 335 | Identity: | 80/335 - (23%) |
---|---|---|---|
Similarity: | 115/335 - (34%) | Gaps: | 139/335 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 EAQLDILMKINSGEYRLVKKNKRSSVWNVYREIARPDGTKLKWRYFCMGCKRVMQSTGGTTSNLR 87
Fly 88 IHKCHVRYIKQNGHLTDGSHSYDHDPAPPAS----------QPS--------------------- 121
Fly 122 ----PRVQ--------------------------------KPKTRRPTSYSTQCEQFYEVTM--- 147
Fly 148 ----------------DPETQY------SDLDDEI--------------------------EASL 164
Fly 165 EEEQTIILQLKSKRELESSHSRPLLKLFSEENLSTEPEEPEDEIE------------IVEAEDQ- 216
Fly 217 VPIELDLCDI 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11560 | NP_001303392.1 | ZnF_BED | 48..93 | CDD:214746 | 28/44 (64%) |
ssp | NP_648546.1 | Myb_DNA-bind_4 | 120..198 | CDD:290549 | 6/77 (8%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0012715 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |