DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11560 and ssp

DIOPT Version :9

Sequence 1:NP_001303392.1 Gene:CG11560 / 39376 FlyBaseID:FBgn0036249 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster


Alignment Length:335 Identity:80/335 - (23%)
Similarity:115/335 - (34%) Gaps:139/335 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EAQLDILMKINSGEYRLVKKNKRSSVWNVYREIARPDGTKLKWRYFCMGCKRVMQSTGGTTSNLR 87
            |:...|..|:..|||||:::.:|.|||.|||||.|.||..:...|||.||||||:|.  .|||||
  Fly    14 ESNQVISAKVLRGEYRLLRRKQRGSVWKVYREIVRTDGAIINGLYFCTGCKRVMRSF--NTSNLR 76

  Fly    88 IHKCHVRYIKQNGHLTDGSHSYDHDPAPPAS----------QPS--------------------- 121
            .|||||.|::.. .|.:...:..|.|....|          |||                     
  Fly    77 THKCHVDYLRTE-ELCEEGIAEIHPPKLDDSLERRLSWNSFQPSEWSFHAVELLLELWARHCVDL 140

  Fly   122 ----PRVQ--------------------------------KPKTRRPTSYSTQCEQFYEVTM--- 147
                .|||                                :....:.|.:.:|.|.|..:.|   
  Fly   141 RDSRKRVQVIWKMTGEMKSLGFTFTEIKNKIDDMGQQYRRESHMEKTTGHKSQWEYFETMKMIFS 205

  Fly   148 ----------------DPETQY------SDLDDEI--------------------------EASL 164
                            .|.|..      |.||:.:                          ||..
  Fly   206 SDRNIIDNMPLDKSGSAPNTTSEHNSFGSQLDEPLIDRNYLRSQKVHPGEGDSFDMNEYADEAQE 270

  Fly   165 EEEQTIILQLKSKRELESSHSRPLLKLFSEENLSTEPEEPEDEIE------------IVEAEDQ- 216
            :.::..||:....||:|.|.:     :.|:||...|.::...:.|            |:|.|:: 
  Fly   271 DVDELRILKDNIIREIEESST-----VHSQENYEDELDQQNSKTEDMKIAKRQRAARIMEIEEEK 330

  Fly   217 VPIELDLCDI 226
            :.||...|.:
  Fly   331 LVIERKKCKL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11560NP_001303392.1 ZnF_BED 48..93 CDD:214746 28/44 (64%)
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549 6/77 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012715
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.