DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11560 and vers

DIOPT Version :9

Sequence 1:NP_001303392.1 Gene:CG11560 / 39376 FlyBaseID:FBgn0036249 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_648545.1 Gene:vers / 39374 FlyBaseID:FBgn0011335 Length:391 Species:Drosophila melanogaster


Alignment Length:193 Identity:43/193 - (22%)
Similarity:75/193 - (38%) Gaps:50/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VYREIAR------PDGTKLKW------RYFCMGCKRVMQSTGGTTSNLRIHKCHVRYIKQNGHLT 103
            :||::||      |..|:||.      |.:.:..:|| :.||..:.....||.....|       
  Fly   182 IYRQMAREMSQFGPSHTELKTKMDNLSRKYRIEAERV-RETGVPSKWEHFHKLQALLI------- 238

  Fly   104 DGSHSYDHDPAPPASQPSPRVQKPKTRRPTSYSTQCEQ--------FYEV----------TMDPE 150
             |:.|.|......|..|:..:...:...|...|:..::        .:|.          |..|.
  Fly   239 -GTKSVDVFEDITAENPAQALFSDEDYEPEELSSLKDEPMAGDDGNVFESDMVASKAMKRTRTPS 302

  Fly   151 TQYSDLDDEIEASLEEEQ----------TIILQLKSKRELESSHSRPLLKLFSEENLSTEPEE 203
            ....::.:|.|...|||:          :.|.:.::||:..::||..||:: .||.|:.|.|:
  Fly   303 PSIPEIPEEDEEEEEEEEDDDHMKDLSPSPISKCQTKRKASNNHSDRLLEI-EEEKLAIEREK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11560NP_001303392.1 ZnF_BED 48..93 CDD:214746 15/53 (28%)
versNP_648545.1 Myb_DNA-bind_4 151..232 CDD:290549 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012715
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.