DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11560 and Y105C5A.15

DIOPT Version :9

Sequence 1:NP_001303392.1 Gene:CG11560 / 39376 FlyBaseID:FBgn0036249 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001294099.1 Gene:Y105C5A.15 / 178442 WormBaseID:WBGene00013639 Length:859 Species:Caenorhabditis elegans


Alignment Length:87 Identity:25/87 - (28%)
Similarity:47/87 - (54%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SGEYRLVKKNKRSSVWNVYREIARPDG-TKLKWRYF-CMGCKRVMQSTGGTTSNLRIHKCHV-RY 95
            :|.::||:|..||.|||::.::.  |. |:::..:. |..||.:...|||.|.|:..|:|.: ..
 Worm   233 NGRFQLVRKRGRSEVWNLFGQVL--DSLTQVRLPFVACYACKVLYTDTGGGTGNMTRHRCPIGAS 295

  Fly    96 IKQNGHLTD-------GSHSYD 110
            .:.:.|.:.       |::|:|
 Worm   296 YRSSTHASSTETVEAGGTNSFD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11560NP_001303392.1 ZnF_BED 48..93 CDD:214746 15/46 (33%)
Y105C5A.15NP_001294099.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012715
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.