powered by:
Protein Alignment ssp and RFA3
DIOPT Version :9
Sequence 1: | NP_648546.1 |
Gene: | ssp / 39375 |
FlyBaseID: | FBgn0036248 |
Length: | 368 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012362.1 |
Gene: | RFA3 / 853266 |
SGDID: | S000003709 |
Length: | 122 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 35 |
Identity: | 12/35 - (34%) |
Similarity: | 16/35 - (45%) |
Gaps: | 9/35 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 KFESNQVISAKVLRGEYRLLRRKQRGSVWKVYREI 46
||:.|:.:| |.|...|.| :.|.|.||
Yeast 96 KFKENEDLS---LNGVVALQR------LCKKYPEI 121
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S12669 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.