DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp and ASIL1

DIOPT Version :9

Sequence 1:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_564648.1 Gene:ASIL1 / 841844 AraportID:AT1G54060 Length:383 Species:Arabidopsis thaliana


Alignment Length:261 Identity:52/261 - (19%)
Similarity:107/261 - (40%) Gaps:42/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WSFHAVELLLELWA-RHCVDLRDSRKRVQVIWKMTGEM----KSLGFTFTEI--KNKIDDMGQQY 178
            ||..|.::|:|.|. |.....:.:.|  |..||...|:    :...:..|:|  ||:||.:.::|
plant    94 WSEEATKVLIEAWGDRFSEPGKGTLK--QQHWKEVAEIVNKSRQCKYPKTDIQCKNRIDTVKKKY 156

  Fly   179 RRESHMEKTTGHKSQWEYFETMKMIFSSDRNII------DNMPLDKS-GSAPNTTSEHNSFGSQL 236
            ::|.....:....|:|.:|:.::.:.......|      :..|:..: |::.::..:..:.|:|:
plant   157 KQEKAKIASGDGPSKWVFFKKLESLIGGTTTFIASSKASEKAPMGGALGNSRSSMFKRQTKGNQI 221

  Fly   237 DEPLIDRN-------YLRSQKVHPGEGDSFDMNEYA-DEAQEDVDELRILKDNIIREIEESSTVH 293
            .:...::.       :.|.:.....|.:|....|.: :|:.|.:..|:.:         :..:.|
plant   222 VQQQQEKRGSDSMRWHFRKRSASETESESDPEPEASPEESAESLPPLQPI---------QPLSFH 277

  Fly   294 SQENYE-DELDQQNSKTEDMKIAKRQRAARIMEIEEEKLVIERKKCKLMKFFVREMSSFHKDFMD 357
            ..:..: |:.....|...|:       |..|:...|.....|..|.|||....:|...|.|: |:
plant   278 MPKRLKVDKSGGGGSGVGDV-------ARAILGFTEAYEKAETAKLKLMAELEKERMKFAKE-ME 334

  Fly   358 L 358
            |
plant   335 L 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549 22/83 (27%)
ASIL1NP_564648.1 Myb_DNA-bind_4 92..177 CDD:404682 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I2640
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.