DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp and msantd1

DIOPT Version :9

Sequence 1:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001314777.1 Gene:msantd1 / 798497 ZFINID:ZDB-GENE-121227-1 Length:274 Species:Danio rerio


Alignment Length:274 Identity:55/274 - (20%)
Similarity:103/274 - (37%) Gaps:78/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LRTEELC----EEGIAEIHPPKLDDSLERRLSWNSFQPSEWSFHAVELLLELWARHCVDLRDSRK 145
            :.:|:||    ..|..|.|         ||       ...|:...::.|:.:|..:..:|:.:::
Zfish     1 MASEDLCFSYTVPGSNEKH---------RR-------ARNWTDSEMKALVYIWEEYVTELKKAKR 49

  Fly   146 RVQV-------IWKMTGEMKSLGFTFTEIKNKIDDMGQQYRRESHMEKTTGHKSQWEYFETMKMI 203
            ..::       ::::|||.:..    .|||.||.:|..|:|:..:..........|.|:::::.|
Zfish    50 NAKIYETMAKQLYELTGEQRHR----EEIKMKITNMTFQFRKLKYTANGGSSTPDWPYYKSIERI 110

  Fly   204 FSSDRNIIDNMPLDKSGSAPNTTSEHNSFGSQLDEPLIDRNYLRSQKVHPGEGDSFDMNEYADEA 268
            .|...:.....|.:.|.|.| :||:|:....|...|   ..:|..   :.|..:..|||:..|. 
Zfish   111 LSKVPDHGHMSPPNLSSSGP-STSQHDPAVPQSAPP---SGFLPE---YTGSSEERDMNDEDDG- 167

  Fly   269 QEDVDELRILKDNIIREIEESSTVHSQENYEDELDQQNSKTEDMKIAKRQRAARIMEIEEEKLVI 333
                     |.||.....|..|..|                      ||:|.:.:.        :
Zfish   168 ---------LTDNSASSFETRSQPH----------------------KRRRLSHVS--------L 193

  Fly   334 ERKKCKLMKFFVRE 347
            .|||.:::...::|
Zfish   194 RRKKLRVLDAMLKE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549 17/84 (20%)
msantd1NP_001314777.1 Myb_DNA-bind_4 22..105 CDD:290549 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5480
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.