DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp and Msantd1

DIOPT Version :9

Sequence 1:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001102559.1 Gene:Msantd1 / 498394 RGDID:1565796 Length:278 Species:Rattus norvegicus


Alignment Length:246 Identity:52/246 - (21%)
Similarity:100/246 - (40%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WSFHAVELLLELWARHCVDLRDSRKRVQV-------IWKMTGEMKSLGFTFTEIKNKIDDMGQQY 178
            |:...:..|:.:|.....:|:.:::..:|       :::|||| :.||   .|||.||.:|..||
  Rat    46 WTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGE-RRLG---EEIKIKITNMTFQY 106

  Fly   179 RRESHMEKTTGHKSQWEYFETMKMIFSSDRNIIDNMPLDKSGSAPNTTSEHNSFG-SQLDEPLID 242
            |:...|..:......|.|:..:..|.:......:....|.....|:|:....|.. |....||  
  Rat   107 RKLKCMTDSESVPPDWPYYLAIDRILAKVPESCEGKLPDGQQPGPSTSQTEASLSPSAKSTPL-- 169

  Fly   243 RNYLRSQKVHPGEGDSFDMNEYADEAQEDVDELRILKDNIIREIEESSTVHSQENYEDELDQQNS 307
              ||      |....|:: ..:.|:..:....|..||..     .|...|..::.....|.::..
  Rat   170 --YL------PYTQCSYE-GRFEDDRSDSSSSLLSLKFR-----SEERPVKKRKMRSCHLQKKKL 220

  Fly   308 KTEDMKIAKRQRAARIME--IEEEKLVIERK---KCKLMKFFVREMSSFHK 353
            :..:..:.:::|.:|.||  ..|.:.|::::   :.:.::...|.||...|
  Rat   221 RLLEAMLEEQRRLSRAMEETCREVRRVLDQQNILQVQSLQLQERMMSLLEK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549 23/83 (28%)
Msantd1NP_001102559.1 Myb_DNA-bind_4 43..125 CDD:290549 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.