DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp and Msantd1

DIOPT Version :9

Sequence 1:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_997160.1 Gene:Msantd1 / 403174 MGIID:2684990 Length:278 Species:Mus musculus


Alignment Length:246 Identity:52/246 - (21%)
Similarity:100/246 - (40%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WSFHAVELLLELWARHCVDLRDSRKRVQV-------IWKMTGEMKSLGFTFTEIKNKIDDMGQQY 178
            |:...:..|:.:|.....:|:.:::..:|       :::|||| :.||   .|||.||.:|..||
Mouse    46 WTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGE-RRLG---EEIKIKITNMTFQY 106

  Fly   179 RRESHMEKTTGHKSQWEYFETMKMIFSSDRNIIDNMPLDKSGSAPNTTSEHNSFG-SQLDEPLID 242
            |:...|..:......|.|:..:..|.:......:....|.....|:|:....|.. |....||  
Mouse   107 RKLKCMTDSESIPPDWPYYLAIDRILAKVPESCEGKLPDGQQPGPSTSQTEASLSPSAKSTPL-- 169

  Fly   243 RNYLRSQKVHPGEGDSFDMNEYADEAQEDVDELRILKDNIIREIEESSTVHSQENYEDELDQQNS 307
              ||      |....|:: ..:.|:..:....|..||..     .|...|..::.....|.::..
Mouse   170 --YL------PYTQCSYE-GHFEDDRSDSSSSLLSLKFR-----SEERPVKKRKMRSCHLQKKKL 220

  Fly   308 KTEDMKIAKRQRAARIME--IEEEKLVIERK---KCKLMKFFVREMSSFHK 353
            :..:..:.:::|.:|.||  ..|.:.|::::   :.:.::...|.||...|
Mouse   221 RLLEAMLEEQRRLSRAMEETCREVRRVLDQQNILQVQSLQLQERMMSLLEK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549 23/83 (28%)
Msantd1NP_997160.1 Myb_DNA-bind_4 43..125 CDD:290549 22/82 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..167 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.