DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp and MSANTD1

DIOPT Version :9

Sequence 1:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001036155.1 Gene:MSANTD1 / 345222 HGNCID:33741 Length:278 Species:Homo sapiens


Alignment Length:219 Identity:47/219 - (21%)
Similarity:90/219 - (41%) Gaps:42/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WSFHAVELLLELWARHCVDLRDSRKRVQV-------IWKMTGEMKSLGFTFTEIKNKIDDMGQQY 178
            |:...:..|:.:|.....:|:.:::..:|       :::|||| :.||   .|||.||.:|..||
Human    46 WTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGE-RRLG---EEIKIKITNMTFQY 106

  Fly   179 RRESHMEKTTGHKSQWEYFETMKMIFSSDRNIIDNMPLDKSGSAPNTTSEHNSFGSQLDEPLIDR 243
            |:...|..:......|.|:..:..|.:......|....|.....|:|:....|    |..|    
Human   107 RKLKCMTDSESAPPDWPYYLAIDGILAKVPESCDGKLPDSQPPGPSTSQTEAS----LSPP---- 163

  Fly   244 NYLRSQKVHPGEGDSFDMNEYADEAQEDVDELRILKDNIIREIEESSTVHSQENYEDELDQQNSK 308
              .:|..::      |..|:.:.|.:.:.|           ..:.||::.|.:...:|...:..|
Human   164 --AKSTPLY------FPYNQCSYEGRFEDD-----------RSDSSSSLLSLKFRSEERPVKKRK 209

  Fly   309 TEDMKIAKRQRAARIME--IEEEK 330
            .:...:.|:|  .|::|  :||::
Human   210 VQSCHLQKKQ--LRLLEAMVEEQR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549 23/83 (28%)
MSANTD1NP_001036155.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Myb_DNA-bind_4 44..125 CDD:316362 22/82 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..168 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.