DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp and CG7239

DIOPT Version :9

Sequence 1:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_608960.2 Gene:CG7239 / 33809 FlyBaseID:FBgn0031740 Length:459 Species:Drosophila melanogaster


Alignment Length:278 Identity:42/278 - (15%)
Similarity:105/278 - (37%) Gaps:65/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WSFHAVELLLELWARHCVDLRDSRKRVQVIWKMTGEMK---SLGFTFTEIKNKIDDMGQQYR--R 180
            |:....|.|.|:|.|....|..:.|......:...|::   ::.....||:.|::....::|  :
  Fly    42 WTPSEEERLYEIWGRDNWRLTRTGKNTIFFGRWAEELRDRFAVDVKPEEIQMKVNQTRAKFRQVK 106

  Fly   181 ESHMEKTTGHKSQWEYFETMKMIFS-----------------SDRNI-----------IDNMPLD 217
            :......:.:.::|:.::.:..|..                 ::|::           :...|..
  Fly   107 KQLQADPSSYATRWKKYDIINRILKNLHRPKNADPLPPEALLNNRDMTPPRDDASAEQLQQQPQQ 171

  Fly   218 KS-----------GSAPNTTSEHNSFGSQLDEPLIDRNYLRSQKVHPGEGDSFDMNEYADEAQED 271
            :|           .|.|:|.:.:||..:.        |:..|...:...|.||:...:.|:..|.
  Fly   172 QSVQQQQQQGLGLASEPSTATYYNSSSNS--------NHGSSHNNNTSGGVSFNTELFTDQYDEV 228

  Fly   272 VDELRILKDNIIREIEESSTVHSQENYEDELDQQNSKTEDMKIAKRQRAARIMEIEEEKLVIERK 336
            |.:  ..:|:..|.|.          ::::| ||.|..|..::.:.|...:..::::::...::.
  Fly   229 VKQ--EYEDDEYRSIP----------FQEQL-QQYSPAEPAQLLELQTPQQQQQLQQQQQQQQQF 280

  Fly   337 KCKLMKFFVREMSSFHKD 354
            :......|.::.:.|:.:
  Fly   281 QTNYESQFQQQPAQFNNN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549 14/81 (17%)
CG7239NP_608960.2 Myb_DNA-bind_4 39..124 CDD:290549 14/81 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22666
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.