DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vers and CG11560

DIOPT Version :10

Sequence 1:NP_648545.1 Gene:vers / 39374 FlyBaseID:FBgn0011335 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001303392.1 Gene:CG11560 / 39376 FlyBaseID:FBgn0036249 Length:307 Species:Drosophila melanogaster


Alignment Length:155 Identity:34/155 - (21%)
Similarity:50/155 - (32%) Gaps:70/155 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 KAFSVIREMIGQGFIPDTSTYSKVLNYLCNASKMELAFLLFEEMKRGGLVADVYTYTIMVDSFCK 530
            :|...:||::|    ||.|              .:|.|.|.:...:|.:                
  Fly    45 EAVDRVRELVG----PDLS--------------KKLDFNLGDLRNKGDI---------------- 75

  Fly   531 AGLIEQARKWFNEMREVGCTPNVVTYTALIH-AYLKAKKVSYAN-------------ELFETMLS 581
                   .|.|::.|          :.|:|| |.|||...|..|             .|:|||..
  Fly    76 -------EKLFSKQR----------FDAVIHFAGLKAVGESVENPRRYFDNNLVGTINLYETMAK 123

  Fly   582 EGCLPNIVTYSALIDGHCKAGQVEK 606
            ..|...:.:.||.:     .||.||
  Fly   124 YNCKMMVFSSSATV-----YGQPEK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
versNP_648545.1 Myb_DNA-bind_4 151..232 CDD:463994
CG11560NP_001303392.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.