DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6793 and Clip1

DIOPT Version :9

Sequence 1:NP_648541.1 Gene:CG6793 / 39369 FlyBaseID:FBgn0036242 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_038945655.1 Gene:Clip1 / 65201 RGDID:67404 Length:2202 Species:Rattus norvegicus


Alignment Length:706 Identity:153/706 - (21%)
Similarity:288/706 - (40%) Gaps:201/706 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ERREPILREKPP--VVISNKRFQRIRAHATQAAKQEQL---HQQQLREEADEKLRIGGEELLRKF 68
            |.|..:...|||  |.:|....|.|      :|.||:|   |.....|....|...|        
  Rat   527 ELRRRLESSKPPGDVDMSLSLLQEI------SALQEKLEVTHTDHQNEVTSLKDHFG-------- 577

  Fly    69 AGRNLCITREEECARELKQLQA--EQLEAKRLAEEESKAARLEHQKNR--------KKRIEAA-- 121
                   ||||...:|:|.|.|  |:|.    .|.||..::|:|....        |.::|.|  
  Rat   578 -------TREEMFQKEIKALHAATEKLS----KENESLRSKLDHANKENSDVIALWKSKLETAIA 631

  Fly   122 --QKLLEQLRP------GPRELQCARLQSEVMR-SVNVQREVQAEFARVNQQQ----KELD---- 169
              |:.:|:|:.      |....:.|.|::::.| .::.|.|:::..::.:.::    ||::    
  Rat   632 SHQQAMEELKVSFSKGIGTDSAEFAELKTQIERLRLDYQHEIESLQSKQDSERSAHAKEMESMKA 696

  Fly   170 --RKIFQ------------------------EQVLRGFEEA----------QQRHKEQCQ----- 193
              .||.:                        |::|...:||          |.::.||.|     
  Rat   697 KLMKIIKEKEDSLEAVKARLDTAEDQHLVEMEEMLSKLQEAEIKVKELEVLQAKYSEQTQVVGHL 761

  Fly   194 --QLSEHKKELLHLIAERERERQA-----TKAKELEEALK-----ERERN------ERMMKDQQA 240
              |||..:::||.|.|.|:...:.     |..::||.|.|     |.|||      ..:.||.|.
  Rat   762 TSQLSVVEEQLLDLDALRKANSEGKLEIETLRQQLEGAEKQIKNLEMERNAESSKANSITKDLQG 826

  Fly   241 K---------------------EKELQAAKQR--KKKDEALASLV-MSD------QRQKRLQML- 274
            |                     |||||..|::  ...:||:::.. |.|      |::::..|| 
  Rat   827 KELMLTSLQSNLNEVNQVKETLEKELQTLKEKFASASEEAVSTQTSMQDTVNKLHQKEEQFNMLS 891

  Fly   275 EEMEQVRCDIHNKAKGDLEQLKRDRAKERVDQRIRRNEKLAKELAPRLHYSAREDEERHKRQLEE 339
            .|:|::|.::     .|:|...::: .||.||.::..|||..::|..:..|.....:..|...|.
  Rat   892 SELEKLRENL-----TDMEAKFKEK-DEREDQLVKAKEKLENDIAEIMKMSGDNSSQLTKMNDEL 950

  Fly   340 MRKVHSAEQAKWRKSKEQAKNARL-----------AVQREEEGLAKKSRQKAEEDRRLAE-EQRL 392
            ..|..|.|:.:.:.:|.. :||.|           |.|.::|...|...:|.|.:.:|.| |:::
  Rat   951 RLKERSVEELQLKLTKAN-ENASLLQKSIGEVTLKAEQSQQEAAKKHEEEKKELENKLLELEKKM 1014

  Fly   393 Q-NHQTNVQFKRQ----------QREEHIQRIRKLRQDLDEQVKKRIEEETRPGTNYNREAQLEE 446
            : :|......|.:          :.||.:|..:|:..|.::::|...|      .|.:....:||
  Rat  1015 ETSHYQCQDLKAKYEKASSETKIKHEEILQNFQKMLVDTEDKLKAAQE------ANRDLMQDMEE 1073

  Fly   447 LREDAFFFDYARQ---LMDEAQAKGCPLKPFIRAVGQYKNDNRIGAE----IRIPRHMITRLPMG 504
            |:..|   |.|:.   |:..|:.:...:...:|.:   |::.::.|:    :::.:..:....:.
  Rat  1074 LKSQA---DKAKSLTYLLTSAKKEIEVMSEELRGL---KSEKQLFAQEASALKLEKGSLLSKLIE 1132

  Fly   505 RRTQGDSQAEGKEK---PSDKQEPNSEKLSKEEKLLRQKIDENLKKIEALVLQEGK 557
            ..|:.....|.::|   .::......|::|:|:::..::..:..:..|:||::..|
  Rat  1133 VETKITLLQEDQQKLWSVNENLHLEKERISEEKQVAEKRYQQEHRDKESLVVEREK 1188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6793NP_648541.1 TPH 86..431 CDD:290579 109/486 (22%)
Clip1XP_038945655.1 CAP_GLY 60..124 CDD:396049
CAP_GLY 213..277 CDD:396049
SbcC <344..802 CDD:223496 68/299 (23%)
Smc 594..1345 CDD:224117 128/618 (21%)
SMC_prok_B 1047..1919 CDD:274008 26/154 (17%)
pneumo_PspA 1838..>2141 CDD:411490
CLIP1_ZNF 2180..2196 CDD:406934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.