DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6793 and Crtp

DIOPT Version :9

Sequence 1:NP_648541.1 Gene:CG6793 / 39369 FlyBaseID:FBgn0036242 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_524736.1 Gene:Crtp / 44276 FlyBaseID:FBgn0029501 Length:745 Species:Drosophila melanogaster


Alignment Length:577 Identity:142/577 - (24%)
Similarity:252/577 - (43%) Gaps:103/577 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PVVISNKRFQRIRAHATQAAKQEQLHQQQLREEADEKLRIGGEELLRKFAGRNLCITREEECARE 84
            |||||.|||..|:..:.|..|..|:...:......:.|:.|.|.|...|...|        ..:.
  Fly    24 PVVISAKRFAAIKGRSRQDEKHAQMEAVEEERRYRQYLKDGNELLCSLFTDPN--------APKV 80

  Fly    85 LKQLQAEQLEAKRLAEEESKAARLEHQKNRKKRIEAAQKLLEQLRPGPRELQCARLQSEVMRSVN 149
            .|..:|:..||..:.::..  .:|..::.||:||..|.:||:||:||||.|..|.:.||::....
  Fly    81 KKSARAQSKEAMAVVKDVD--TKLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRK 143

  Fly   150 VQREVQAEFARVNQQQKELDRKIFQEQVLR-GFEEAQQRHKEQCQQLSEHKKELLHLIAERERER 213
            ....:..|.|...:.|:..|.::....::. |....::....|..:..||.:.:...||:|.|  
  Fly   144 YNEALNEEIAEAARAQERADEEMCPAALVPFGHATEEEEVARQTAKNMEHAELMRADIAQRAR-- 206

  Fly   214 QATKAKELEEALKERERNERMMKDQ----QAK---EKELQAAKQRKKKDEALASLVMSDQRQKRL 271
                       ::|.||.:|:.::|    |.|   :||.:|.|::|.:..|.......:..|::.
  Fly   207 -----------IREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRKAYKEALQEKA 260

  Fly   272 QMLEEMEQVRCD----------------IHNKAKGDLEQLKRDRAKERVDQRIR---RNEKLAKE 317
            ::.|. |:: ||                :.::....::||::.|.:||..|.:|   ..:.|.|:
  Fly   261 EIAEH-ERI-CDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQKRQEERELQALRVSQAQQVLQKK 323

  Fly   318 LAPRLHYSAREDEERH--KRQLEEMRKVHSAEQAKWRKSKEQAKNARLAVQREEEGLAKKSRQKA 380
            |..|    ..:.|:||  :.|:::.|:         :..:|.....|.|.|:.|.      :|.|
  Fly   324 LEER----QIDAEDRHAFETQVDDSRR---------QCEREMLAKERRAYQKLER------KQDA 369

  Fly   381 EEDRRLAEEQ------RLQNHQTNVQFKRQQREEHIQRIRKLRQDLDEQVKKRIEEETRPGTNY- 438
            |:.||..|.|      ||:|.:.|..|...|:.:..:...:||..|..|.::.:|:......|. 
  Fly   370 EKLRRQQELQRFHVARRLKNAEANRFFDASQKRKRDKVKEELRNVLFGQREEFLEKRRAELMNLA 434

  Fly   439 --NREAQLEELREDAFFFDYARQLMDEAQAKGCPLKPFIRAVGQYKNDNRIGAEIRIPRHMITRL 501
              |.:..||   :|..||:.|.::|:|::..|.||.|...||.:|:..|::  ::|         
  Fly   435 ACNEDPYLE---DDKKFFEQAVEIMEESRKVGRPLYPIATAVDRYERQNQL--DMR--------- 485

  Fly   502 PMGRRTQGDSQAE-------GKEKPSDKQEPNSEKLSKEEKLLRQKIDENLKKIEAL 551
            |.||..:..|..:       .|.:.:.::....||..:|:...|.:|..|..||:.|
  Fly   486 PEGRMVKRSSLRDYCWPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6793NP_648541.1 TPH 86..431 CDD:290579 91/379 (24%)
CrtpNP_524736.1 PTZ00121 <243..>461 CDD:173412 55/241 (23%)
PHA03307 575..>745 CDD:223039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CAYV
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39944
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.