DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6793 and Hmmr

DIOPT Version :9

Sequence 1:NP_648541.1 Gene:CG6793 / 39369 FlyBaseID:FBgn0036242 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_038580.2 Gene:Hmmr / 15366 MGIID:104667 Length:794 Species:Mus musculus


Alignment Length:699 Identity:155/699 - (22%)
Similarity:268/699 - (38%) Gaps:214/699 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LREKPPVVISN----KRFQRI-RAHATQAAK-QEQLHQQQLREEADEKLRIGGEELLRKFAGRNL 73
            :|||..:..||    ||...: ||:....|| .|..||:.:|..:.|.:::..:   |:...|::
Mouse   124 VREKTSLSASNASLEKRLTELTRANELLKAKFSEDGHQKNMRALSLELMKLRNK---RETKMRSM 185

  Fly    74 CITREEECARELKQLQAEQLEAKRLAEEESKAARLEHQ--KNRKKRIE---AAQKLLEQLRPGPR 133
            .:.:|   ..||| |||.|   |.|.|.:.|..:||.:  ...|::|:   ..:||||.:    :
Mouse   186 MVKQE---GMELK-LQATQ---KDLTESKGKIVQLEGKLVSIEKEKIDEKCETEKLLEYI----Q 239

  Fly   134 ELQCARLQSEVMRSVNVQREVQAEFARVNQQQKELDRKIFQEQVLRGFEEAQQRHKE------QC 192
            |:.||..|.|         :.:.:.|::.:..||.||:|.  .:.:..||.....|:      :|
Mouse   240 EISCASDQVE---------KCKVDIAQLEEDLKEKDREIL--SLKQSLEENITFSKQIEDLTVKC 293

  Fly   193 QQLSEHKKELLHLIAERERERQATKAKELE-----EALKERERNERMMKDQQA-----KEKELQA 247
            |.|...:..|:    .::|||..|.:.|::     .||:.:|..:...|:.|:     :||||.|
Mouse   294 QLLETERDNLV----SKDRERAETLSAEMQILTERLALERQEYEKLQQKELQSQSLLQQEKELSA 354

  Fly   248 AKQRKK--------------KDE---ALASLVMSDQRQKRLQMLEEMEQVRCDIHNKAKGDLEQL 295
            ..|::.              |:|   |||.|....|::      |:.|::...:..:.|...|||
Mouse   355 RLQQQLCSFQEEMTSEKNVFKEELKLALAELDAVQQKE------EQSERLVKQLEEETKSTAEQL 413

  Fly   296 KRDRAKERVDQRIRRNE-KLAKELAPRLHYSA----------------------REDEERHKRQL 337
                  .|:|..:|..| :|.|.:|  .|..|                      ...:|::....
Mouse   414 ------TRLDNLLREKEVELEKHIA--AHAQAILIAQEKYNDTAQSLRDVTAQLESVQEKYNDTA 470

  Fly   338 EEMRKVHS---AEQAKWRKSKEQAKNARLAVQREEEGL--------------------------- 372
            :.:|.|.:   :||.|:..:.:..::....::.|:|..                           
Mouse   471 QSLRDVTAQLESEQEKYNDTAQSLRDVTAQLESEQEKYNDTAQSLRDVTAQLESVQEKYNDTAQS 535

  Fly   373 ----------AKKSRQKAEEDRRL------------------AEEQRLQNHQTNVQFKR-----Q 404
                      .|.|..|..||.:|                  .::|.|....||.::.|     |
Mouse   536 LRDVTAQLESYKSSTLKEIEDLKLENLTLQEKVAMAEKSVEDVQQQILTAESTNQEYARMVQDLQ 600

  Fly   405 QR----EEHIQRI------------RKLRQDLDEQVKKRIEEETRPGTNYNREAQLEE-LREDAF 452
            .|    ||.|:.|            .:|||. ||..:|::||:.:      |.|:.|. :.|...
Mouse   601 NRSTLKEEEIKEITSSFLEKITDLKNQLRQQ-DEDFRKQLEEKGK------RTAEKENVMTELTM 658

  Fly   453 FFDYARQLMDEAQAKGCPLKPFIRAVGQYKNDNRIGAEIRIPRHMITRLPMGRRTQGDSQAEGKE 517
            ..:..|.|.:|...|   .|||.:.:..::.:.    :..:..|..|:..:.:.....:|..|.:
Mouse   659 EINKWRLLYEELYEK---TKPFQQQLDAFEAEK----QALLNEHGATQEQLNKIRDSYAQLLGHQ 716

  Fly   518 KPSDK-------QEPNSEKLSKEEKLLRQKIDENLKKIEALVLQEGKDK 559
            ....|       ::.||:..|:..||..|.:.   :|...|.||...||
Mouse   717 NLKQKIKHVVKLKDENSQLKSEVSKLRSQLVK---RKQNELRLQGELDK 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6793NP_648541.1 TPH 86..431 CDD:290579 105/484 (22%)
HmmrNP_038580.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87
HMMR_N 16..338 CDD:292527 64/242 (26%)
DUF342 <277..431 CDD:302792 42/169 (25%)
5 X 21 AA tandem repeats 442..546 8/103 (8%)
HMMR_C 636..789 CDD:292530 31/143 (22%)
Hyaluronic acid-binding. /evidence=ECO:0000255 719..729 1/9 (11%)
Hyaluronic acid-binding. /evidence=ECO:0000255 741..750 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.