DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rols and AT1G07710

DIOPT Version :9

Sequence 1:NP_729778.1 Gene:rols / 39368 FlyBaseID:FBgn0041096 Length:1900 Species:Drosophila melanogaster
Sequence 2:NP_001318946.1 Gene:AT1G07710 / 837285 AraportID:AT1G07710 Length:543 Species:Arabidopsis thaliana


Alignment Length:340 Identity:97/340 - (28%)
Similarity:152/340 - (44%) Gaps:69/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1404 VGLTNSQGCTPLILAAMRGHCDVVRPLVAAGSSLGQLDITQR---CALVHAARMGHLSVVKYLLA 1465
            :|..|..|.|.|.:||..|..::|:.::.. ..|..::|..|   .|...||:.|.|.|:|.|  
plant    59 LGKQNQSGETALYVAAEYGDVEIVKEMINC-YDLALVEIKARNGFDAFHIAAKQGDLDVLKVL-- 120

  Fly  1466 CDWSPRPHSQ-----DVTRSVALQQALIGAAAQAHCKILEDLLDLNETEFDLDVNGMEPSSGELA 1525
                ...||:     |::.:.||..    ||.|.|.:::..||:|..:     :.|:..|:|:.|
plant   121 ----AEAHSELAMTVDLSNTTALHT----AATQGHTEVVNFLLELGSS-----LAGIAKSNGKTA 172

  Fly  1526 LTAAARHGCIDVVGILLSRGAQIDAR-NRQGYSALWLAVKEGHWSVVEHLLQ--RGALLDEPLGQ 1587
            |.:|:|:|.:.|:..||:....|..| :::|.:||.:|||..:..|||.|::  |.::   .:..
plant   173 LHSASRNGHVKVIKALLASEPAIAIRMDKKGQTALHMAVKGTNVEVVEELIKADRSSI---NIAD 234

  Fly  1588 TR-KTPLMIAAEEGHLELVDLLLARG-AQREAQDHEGFTALSWA----------CLRGH-LAAAK 1639
            |: .|.|.|||.:|..::|.||||.. ...:|.:..|.|||..|          .|:.| :.:||
plant   235 TKGNTALHIAARKGRSQIVKLLLANNMTDTKAVNRSGETALDTAEKIGNPEVALILQKHGVPSAK 299

  Fly  1640 TLIEHGCNR-----------HHEDHN--GRTALDLAAYQGAASLVIYILEQGGNLEHIDVHGMRP 1691
            |:...|.|.           .||.||  ..|.|.....||.|.          .|..:...|   
plant   300 TIKPSGPNPARELKQTVSDIKHEVHNQLEHTRLTRKRVQGIAK----------QLNKMHTEG--- 351

  Fly  1692 LDRAIACRNIQAVQV 1706
            |:.||....:.||.:
plant   352 LNNAINSTTVVAVLI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rolsNP_729778.1 zf-RING_5 327..364 CDD:291308
Ank_5 1363..1418 CDD:290568 5/13 (38%)
ANK 1378..1503 CDD:238125 29/106 (27%)
ANK repeat 1382..1408 CDD:293786 1/3 (33%)
ANK repeat 1410..1441 CDD:293786 8/30 (27%)
Ank_2 1415..1552 CDD:289560 41/145 (28%)
ANK 1486..1609 CDD:238125 40/126 (32%)
ANK repeat 1486..1518 CDD:293786 8/31 (26%)
ANK repeat 1521..1552 CDD:293786 11/31 (35%)
Ank_2 1526..1619 CDD:289560 33/97 (34%)
ANK 1549..1675 CDD:238125 46/154 (30%)
ANK repeat 1554..1586 CDD:293786 11/33 (33%)
ANK repeat 1591..1619 CDD:293786 12/28 (43%)
Ank_2 1593..1685 CDD:289560 33/116 (28%)
ANK repeat 1621..1652 CDD:293786 13/52 (25%)
ANK repeat 1654..1685 CDD:293786 7/32 (22%)
Ank_2 1659..1735 CDD:289560 11/48 (23%)
ANK repeat 1687..1712 CDD:293786 6/20 (30%)
TPR_11 1736..1812 CDD:290150
TPR repeat 1736..1768 CDD:276809
TPR repeat 1773..1810 CDD:276809
TPR_11 1783..1843 CDD:290150
TPR repeat 1815..1843 CDD:276809
AT1G07710NP_001318946.1 ANK repeat 26..63 CDD:293786 1/3 (33%)
Ank_2 31..127 CDD:372319 22/74 (30%)
ANK repeat 65..98 CDD:293786 9/33 (27%)
ANK repeat 100..132 CDD:293786 10/37 (27%)
ANKYR 108..312 CDD:223738 68/221 (31%)
ANK repeat 134..166 CDD:293786 10/40 (25%)
ANK repeat 168..200 CDD:293786 11/31 (35%)
ANK repeat 202..234 CDD:293786 11/34 (32%)
ANK repeat 270..294 CDD:293786 6/23 (26%)
PGG 349..466 CDD:372845 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1009
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.